KEGG   Geospiza fortis (medium ground-finch): 102038516Help
Entry
102038516         CDS       T03755                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr05164  Influenza A
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    102038516 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gfr01002]
    102038516 (TMPRSS2)
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102038516 (TMPRSS2)
Peptidases [BR:gfr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102038516 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR Ldl_recept_a SRCR DUF1986 DUF3149 DUF3139
Motif
Other DBs
NCBI-GeneID: 102038516
NCBI-ProteinID: XP_005427313
LinkDB All DBs
Position
Un
AA seq 449 aa AA seqDB search
MTSTLGPPPPYYENRGFQPEAPYTARPAAGAHPYPQLFSTNPPSVPSYVPRVATHQSSRP
AAPPPRRTCAASLRKTIIIILSILIVICCAIAAFFIWYFVENHCLSSLIECGSSGVCMPP
SQWCDGVSDCPNGEDETRCVRLFGPNFILEVYSPVSKSWYPVCHDDWNDDYGKIACKDMG
YSVDTYFYSRGVPDVSFKSYMKLNTSAGNIDLYKKLYSSGSCASESVVSLRCIECGLPSK
SVSIMNRIVGGSGAVLGRLSDPHSWRVYAGILNQDEMLFRSGYKVQLIISHPDYDTDSKD
NDVALMKLETPLSFTETVRPVCLPNPGMMFQPNQQCWISGWGAEYQGGKTSNNLNYVAVP
LIERSRCNAVYIYNGMILPTMICAGDLAGGIDSCQGDSGGPLVTHHHSVWWLVGDTSWGT
GCATPNKPGVYGNMTVFTDWIYKNMQANR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgacctctactctaggtcctccaccgccatactacgagaacaggggcttccagccagag
gccccctacactgccaggccggcagcaggtgctcacccctacccacagctcttctccaca
aaccctccctccgtgccaagctacgtcccaagggttgccacccaccagtccagcaggcca
gcagcacccccacccaggagaacctgtgcagccagtctaaggaaaaccataataataata
ttatctatattaatagtcatttgttgtgcaattgctgctttcttcatatggtattttgta
gagaatcactgtctcagctccctgattgagtgtggctcctcaggggtgtgcatgcccccc
tcccagtggtgtgacggagtgagcgactgccccaacggggaggacgagacccgctgtgtt
agactttttggaccaaattttatcctggaagtttattcacctgtcagcaaatcctggtat
cctgtttgccacgatgactggaatgatgattatgggaagattgcatgcaaagacatgggc
tacagcgtggatacatatttctacagtcgtggggtacctgacgtcagctttaagagctac
atgaagctgaacacaagtgctgggaatatagacttgtacaaaaagctgtacagcagtggt
tcctgtgcctcagaaagtgtggtttctctgcgctgcatagagtgtggcctgcccagcaag
agcgtgagcatcatgaacaggatcgtggggggcagcggggccgtgctggggcgactgtct
gacccacacagctggagggtttatgctgggattctcaatcaggatgagatgctcttcaga
agtggatacaaagtgcaattgataatttctcacccagattatgacacggactccaaagac
aacgatgttgcccttatgaagctggagacaccactgagttttactgaaactgtgaggcca
gtttgtctgcccaatccaggaatgatgttccagcctaaccagcagtgctggatatcaggg
tggggagcagagtaccaaggaggtaaaacatcaaataacttgaattacgttgcggtgccc
ctcatagaacgttccaggtgtaatgctgtttatatctacaatggcatgattctgcctaca
atgatctgtgctggagacctagcagggggaattgattcctgtcagggtgacagtggaggt
cctctggtgactcaccaccactctgtgtggtggctggttggagacaccagctggggcact
ggctgcgccactcccaacaaacctggagtgtatgggaatatgactgtgtttacagactgg
atttataaaaatatgcaggcaaacagatga

DBGET integrated database retrieval system