KEGG   Geospiza fortis (medium ground-finch): 102038763Help
Entry
102038763         CDS       T03755                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04010  MAPK signaling pathway
gfr04210  Apoptosis
gfr04625  C-type lectin receptor signaling pathway
gfr04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102038763 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102038763 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102038763 (MAP3K14)
   04672 Intestinal immune network for IgA production
    102038763 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gfr01001]
    102038763 (MAP3K14)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102038763 (MAP3K14)
Protein kinases [BR:gfr01001]
 Serine/threonine kinases: STE group
  Other
   102038763 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 102038763
NCBI-ProteinID: XP_014165830
LinkDB All DBs
Position
Un
AA seq 819 aa AA seqDB search
MAPTWRGRHRGRARKKRHKKRSKLKGQPVAAGRRSPRTPEQESCTPIPVQEDESHQSTLY
RNSFWVPEFNKDLGYDPLPFEKPAHAPFSVGKLHSPRSQYKTELHKLISPIQCLNHVWKQ
RDTVPQPETLRPFPYNILPPHFPHVDNPLRAMKQNALDTYIHGDLNYQDSHLSGLNLEYN
FTKCINQSVQTSSDKLSVEEYLVDALKGSVSFGEPQNLASLAKTWRGGGLELKEQFHEAS
ENEGVLLNEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKIEDKQTGFQCAAKKVQVEH
FRAEELTTCAAVSSPSVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQSGCLPEDRALSY
LGQVLEGLEYLHAQNILHGDVKAENVLLSDDGSRALLCDFGHSAHLHPDGLGKCLVTGNY
VPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHPLCLKIAKEPPPL
REIPPSCNPLTAEIIKLGLEKEPLQRASASELKTKTSMALEEVGGVRSPWKGEYREPRHF
SLNKENSAQTSLSPTVSPVSEIGSDPKLSVKVSCGSPLLPPPSLEQTEEVEGPHWNEGKE
LPETCDPPPLSSTPLPLKSCSHVERATTISEQELQQLEIELFLNSLSQPYSLEEQEQMLS
CLSIDSPFVSDASEKNSMKASQSLRDTMSSGIHSWSSQAEGQSCSWNNLLSRSRHTDTPS
CFNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQVRHRLELSIPVPAFSLVTKEGQP
VHYNMEVPDSGIELQCTLAPDCSVGWAWRVKHGQLENRP
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atggcacccacctggagagggaggcaccggggcagggccaggaagaaaaggcacaagaaa
agatccaagctgaaaggacaacctgtggctgctggcaggagaagtccaagaactccagaa
caggagagctgcaccccaattcctgtccaggaggatgaatcccaccaaagcactctttac
agaaacagtttttgggttcctgaatttaacaaggacttgggctatgatccactgcctttt
gagaagcctgcccatgcccctttttctgtgggcaaactccattccccaaggagccagtac
aaaactgaactgcacaagttgatcagccctattcagtgccttaatcatgtttggaaacag
agggacactgttccccagcctgagactctccgtcctttcccctacaacatccttcccccc
catttcccacacgtggacaatcctctccgtgccatgaagcagaatgctctggacacatac
atccatggtgacctcaactatcaagacagtcacttatctggcctaaacttagaatataat
ttcaccaaatgcatcaaccagtccgtgcaaaccagttctgacaaactttctgtggaagaa
tatttggtagatgccttgaaggggagtgtgagttttggagaaccacaaaatttagccagc
ctggccaagacgtggagaggaggtgggctggagctgaaggaacaattccatgaagcaagt
gaaaatgaaggcgtgctgctgaacgagaagctgaagccggtggattacgagtaccgagaa
gaggttcactggaccaagtgccatggttccttgggcattggctcttttggggaggtgtac
aagatagaggacaagcagacaggattccagtgtgctgccaaaaaggtgcaggtggaacat
ttccgtgccgaggagctgacgacgtgcgcggccgtgagcagccccagcgtggtgcccctg
tacggtgctgtcaaggagggtccctgggtcaccatcttcatgaagctcatggagggtggg
tcattagggcagctcattaaacagagtggctgcctgccagaggacagagccctcagctac
ctgggccaggtgttagagggtctggagtatcttcatgctcaaaacattctccatggagat
gtcaaagctgagaacgtgctgctgtcagatgatgggagcagggccctcctgtgtgacttt
ggccactctgctcacctgcacccagatgggctgggaaagtgcttggtcacagggaactac
gtgcctggcacagagacccacatggcccccgaggtggtgatggggaagcgctgtgactcc
aaggtggacgtgtggagcagctgctgcatgatgctgcacatgctcaatggctgccacccc
tggacccagtactacaaccaccctctctgcctgaagatcgctaaagagccgcctcctctg
agggaaattccaccttcctgcaaccctctcactgctgagattattaagctggggctggag
aaggagcctctgcagagggcgtctgcatcagagctcaaaaccaagaccagcatggcactt
gaggaagtgggaggtgtgagaagcccttggaaaggtgaatacagagagcccagacatttc
tctttgaacaaagaaaacagtgcacagacatccctgtcccccacagtgagcccagtttct
gagattggttctgacccaaaactgtcagtcaaagtttcctgtggcagcccactcctacca
cctccatctctggagcaaacagaggaggttgagggacctcactggaatgagggcaaggag
ttacctgagacctgtgatcccccacccctctcctcaactcctctgcccctgaagagctgc
agccacgtggaaagagccacaaccatttcagagcaagaacttcagcagctggaaattgaa
ctgtttctgaacagcctttcccagccttactctctggaagagcaagagcaaatgctttca
tgcctcagcattgacagcccctttgtgtcagatgccagtgagaagaactccatgaaggct
tctcagagcttgagggacaccatgagctctgggatccattcctggagcagccaggcagag
gggcagagctgcagctggaacaacctgctgagccgcagccggcacacggacacccccagc
tgcttcaacggagtgaaaatccagatccagttgctaagtggagaaaatttgcacatcaga
gatttccacaggacaaaggtgggagacattgccacggggataagcagccaggtgagacac
agactggagctcagtatccccgtgcctgccttcagcctggtgaccaaggaggggcagcct
gtgcactacaacatggaggtgcctgactctggcatcgagctgcagtgcaccctggccccc
gactgcagcgtgggctgggcctggcgcgtcaagcacggccagctggagaacaggccctga

DBGET integrated database retrieval system