KEGG   Geospiza fortis (medium ground-finch): 102038788
Entry
102038788         CDS       T03755                                 

Gene name
CHEK2
Definition
(RefSeq) checkpoint kinase 2
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04110  Cell cycle
gfr04115  p53 signaling pathway
gfr04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102038788 (CHEK2)
   04115 p53 signaling pathway
    102038788 (CHEK2)
   04218 Cellular senescence
    102038788 (CHEK2)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102038788 (CHEK2)
Protein kinases [BR:gfr01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   102038788 (CHEK2)
DNA repair and recombination proteins [BR:gfr03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102038788 (CHEK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Kinase-like YrbL-PhoP_reg Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 102038788
NCBI-ProteinID: XP_005421491
UniProt: A0A6I9HIT6
LinkDB
Position
Un
AA seq 521 aa
MSRETVSEAQQSQSAQQPQSGTSSSSGSQSTSQSSLSSGTLSSLDTVPTQELPSIPEDQE
SEELVPQPWGRLFALGKGFSNCDCVNEEYWFGRDKSCDYSFSKLGLSETGFYQNYSKKHF
RIFREMGPRNSYVAYIEDHSANGTFVNRELIGRGRRLPLTHNSEIALSVQTNKVFVFSDL
MVDDQMMFPKEFREKYIMSKTLGSGACGEVKLAFEKSTCNKVAVKIINKRKFVASGLSEE
NPGLNINTEIEILKKIDHPCLIKIKNFFEAEDYYIVLELMEGGELYDRVSRPIKMKEDIC
KLYFYQMLLAVKYLHDNGIIHRDLKPENVLLSSTEETCLVKITDFGQSKILGEASLMKTL
CGTPMYLAPEVLNSLGTAGYSRAVDCWSLGVILFVCLCGYPPFNEQNTQLSLRDQITHGK
YTFIPKEWKHVSDMALDLVKKLLVVDPSKRLTTEEALEHPWLQDEDMKATFEQLLAQTRT
NMNSPETSKMPTTTRKRPHENEEDNGSAKRAVPSTSYQKMR
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtctcgagagactgtaagtgaagcacagcagtctcagagtgcccagcagccacagagt
gggaccagttcttccagtggctcacagagcactagtcagtcttccttaagttctgggact
ctcagttccttggacactgttcccactcaggagcttccctccatccctgaggaccaggaa
tctgaagagctggttcctcagccttggggtcgactctttgctcttggaaaaggtttcagc
aactgtgactgtgtcaatgaggagtactggtttgggagggacaaaagctgtgattacagc
ttttctaagctgggattgtctgagactggcttctaccaaaattatagcaagaagcacttc
cgaattttcagggaaatgggtccaagaaattcctatgttgcctacattgaagaccacagt
gcaaatgggacatttgttaatagagagctcattggaagagggaggaggcttccactgaca
cacaactctgaaattgcattgtctgtacagaccaataaggtgtttgtattttctgatctt
atggtggatgatcagatgatgtttcctaaagaattcagagagaaatatattatgtcaaag
actttgggaagtggtgcctgtggagaagtcaaactggcatttgagaagagcacctgtaac
aaagttgcagtgaaaatcatcaataaacggaagtttgtggcaagtggcctgagtgaagaa
aacccaggtttaaatatcaatacagaaatagaaattttgaagaaaatagatcatccttgc
ttaatcaagattaaaaacttcttcgaagcagaggattactacattgttttggaactgatg
gaaggaggagaattgtatgacagagtgtcaaggccaatcaagatgaaagaagatatctgc
aagttgtacttttatcagatgctgctggcagtaaagtatcttcatgacaatggaattata
caccgagatctaaagccagaaaatgtgctgctttcatctactgaagaaacatgtcttgta
aagattacagattttggacaatccaagattcttggagaagcttctcttatgaaaacatta
tgtggtactcccatgtatcttgctcctgaggttctaaattcacttgggactgctggatac
agccgagctgtggactgctggagtttaggagttattctttttgtatgcttgtgtggatat
ccaccattcaatgagcaaaacactcaactctctctgagggatcaaatcactcatggaaaa
tacacatttattccaaaagagtggaagcatgtgtcagacatggctctggatctggtgaag
aagctgttagtggtggatccaagcaaacgtcttaccacagaggaggccttagagcatcct
tggctgcaggatgaggatatgaaagctacatttgaacagctacttgctcagacacgtacc
aatatgaactcacctgaaacatcaaaaatgccaaccacaacgagaaagcgtccccacgaa
aatgaggaagacaatggctctgctaaacgtgctgttccttctacctcctatcagaaaatg
aggtga

DBGET integrated database retrieval system