KEGG   Geospiza fortis (medium ground-finch): 102039030
Entry
102039030         CDS       T03755                                 

Gene name
CASP9
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
gfr04210  Apoptosis
gfr04370  VEGF signaling pathway
gfr05164  Influenza A
gfr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102039030 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102039030 (CASP9)
   04115 p53 signaling pathway
    102039030 (CASP9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    102039030 (CASP9)
   05168 Herpes simplex virus 1 infection
    102039030 (CASP9)
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     102039030 (CASP9)
Protein phosphatases and associated proteins [BR:gfr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102039030 (CASP9)
Peptidases and inhibitors [BR:gfr01002]
 Cysteine peptidases
  Family C14: caspase family
   102039030 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD
Other DBs
NCBI-GeneID: 102039030
NCBI-ProteinID: XP_014165459
UniProt: A0A6I9Z9R2
LinkDB
Position
Un
AA seq 382 aa
MLEELQSAGSRGEQARQLIIDLETRGKQAFPAFLSILRDTGQGDLAEMLIQECESRPVPR
QLPDLRPVELELREEKQRKNVTPHERLSIPVQAESERPRMPPVLAWGSAVDKRSRDQDYD
MKADPCGHCLILNNVSFSRDSGLSTREGSDIDCEKLERRFRALRFTVLTRRDLKAQEMVL
ELLKLSRQDHSALDCCIVVILSHGCQTSHIQFPGGVYGTDGKPIPIEKIVNYFNGSNCPS
LRGKPKLFFIQACGGEQRDQGFVVDCDSPEEEAPGGSLESDATPFRVSSDNVDEPDAIAS
LPTPSDILVSYSTFPGFVSWREKSSGSWYVETLDSVLEQYAHSEDLLSMLVRVAHAVSAK
GRYKQIPGCFNFLRKKFFFTCH
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgctggaggagctgcagagcgctggcagccgaggagagcaagcccggcagctgatcatt
gacctggagactcgagggaagcaggccttccctgccttcctctccatcctgcgggacacc
gggcagggcgaccttgctgagatgctgatccaggagtgcgaatcccggccggtgccacgg
cagctgccggacctgcggcccgtggagctggagctgcgggaggaaaaacagcgtaaaaat
gtgacccctcacgaacgtttgtctatcccagtgcaagctgagagtgaaagacctcgaatg
cctccagtgctggcctggggttctgctgttgacaagaggagccgtgaccaggattatgac
atgaaagcggatccctgtggacactgcttgatcctcaataacgtcagtttctccagagac
tcgggtctgtccacccgagagggctctgacattgactgcgagaagctggagaggcgcttc
agggccttgcgcttcactgtcctgacccggcgggatctgaaagctcaggaaatggtgttg
gagctgctgaagctgtctcggcaggaccacagtgctttggactgctgcattgtggtcatc
ctttcccatggctgtcagacgagccatattcagtttcctggaggcgtttatggaacggat
ggaaaacccattcccatagaaaagattgtgaactatttcaatgggtccaattgcccgagt
ttgagaggaaaacccaaactgttcttcatccaggcctgtggtggagaacaaagggatcaa
ggctttgtagtggattgtgattcgcctgaagaggaagctcctgggggttccttggaatcg
gacgcgaccccgtttcgggtttcatcggataatgtggacgagcccgatgccattgccagt
ttgcccacacctagtgacatcttggtttcctactcaacttttccaggttttgtctcctgg
agggagaagtcgagtggctcgtggtatgtggaaaccctggacagtgtgctggagcagtat
gcccattcagaagacctgctcagcatgttagtgagggtggcacacgctgtctctgccaag
gggaggtacaagcagatcccaggatgtttcaatttcctccgtaaaaaattcttcttcacg
tgccactga

DBGET integrated database retrieval system