KEGG   Geospiza fortis (medium ground-finch): 102039036
Entry
102039036         CDS       T03755                                 

Gene name
CHEK1
Definition
(RefSeq) checkpoint kinase 1
  KO
K02216  serine/threonine-protein kinase CHEK1 [EC:2.7.11.1]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04110  Cell cycle
gfr04115  p53 signaling pathway
gfr04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102039036 (CHEK1)
   04115 p53 signaling pathway
    102039036 (CHEK1)
   04218 Cellular senescence
    102039036 (CHEK1)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102039036 (CHEK1)
Protein kinases [BR:gfr01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   102039036 (CHEK1)
DNA repair and recombination proteins [BR:gfr03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102039036 (CHEK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo Pkinase_fungal Baculo_VP1054
Other DBs
NCBI-GeneID: 102039036
NCBI-ProteinID: XP_005429402
LinkDB
Position
Un
AA seq 464 aa
MPTVCPLRSWVQLAVNRRTEEAVAVKIVDMKRAAECPENIKKEICINKMLSHENVVRFYG
HRREGATQYLFLEYCRGGELFDRIEPDVGMPEPEAQRFFQQLIAGVVYLHSIGITHRDLK
PENLLLDERDNLKISDFGLATVFRHNGRERLLNKMCGTLPYVAPELLRRPEFRAEPVDVW
ACGVVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLPPWKKIDSAPLALLHKILTESPTA
RITIPDIQKDRWYSRPLKKDVKRARLSSGGVTDSPGGFSKHIRSDTDFSPVKGALGEDKA
SYSTSQPEPGTGGMPWESGTGSIDQLVQGFSFSQPACPEHMLVNSQLLGTPGSSQSPWQR
LVKRMTRFFTKLDADGSYRALKEVCEKMGYGWKMSCTNQVTISTTDRRNNKLIFKVNLVE
MESKILVDFRLSKGDGLEFKRHFLKIKAKLSDIVSTQKVWLPGT
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgcccactgtttgcccgctccggtcgtgggtgcagctggccgtgaaccgccgcaccgag
gaggccgtggccgtgaaaatcgtggacatgaagcgcgcggccgagtgcccggagaacatc
aagaaggaaatctgcatcaacaagatgctgagccacgagaacgtcgtccggttctacgga
caccggcgggagggggccacgcagtacctgttcctggagtactgccgcggcggggagctc
ttcgaccgcatcgagccagatgtcgggatgccagagccggaggcacagcggttcttccag
cagctgattgccggcgtggtgtacctgcacagcattggcatcacccaccgggacctgaag
ccggagaacctgctgctggacgagcgagacaacctgaagatctcggatttcgggctggcc
acggtgttccggcacaacgggcgggagcggctgctgaacaagatgtgcgggaccctgccc
tacgtggcccccgagctgctgcggcgccccgagttccgcgcagagcccgtcgacgtctgg
gcctgcggcgtggtgctgacagccatgctggccggagagctgccttgggaccagcccagc
gacagctgccaggaatacagtgactggaaggagaagaaaacctacctcccaccttggaag
aagattgattccgctcccttggcgctgctgcacaagatcctcacggagagcccgacagcc
aggatcaccattcctgacatccagaaggaccggtggtacagcagacccctcaaaaaggat
gtcaagcgggctcgtctctcctcggggggagtcaccgactcccctggaggcttctccaag
cacatccgatccgatacagacttctcacccgtgaagggagcgctgggtgaggacaaggca
agctattccacgtcacagccggagcccggcacgggcgggatgccctgggagagtggcacg
ggaagcatcgaccagctggtgcagggcttcagcttctcgcagcccgcctgccccgagcac
atgctggtcaacagccaactcctgggcaccccaggctcctcccagagcccgtggcagcgg
ctggtgaagcggatgacgcggttcttcaccaagctggacgccgacggctcctaccgcgcg
ctgaaggaggtgtgtgagaagatgggctacggctggaagatgagctgcaccaaccaggtc
accatctcgaccacagacaggaggaacaacaaactcatcttcaaggtgaacctggtggag
atggagagcaagattttggtggattttcgcctctccaagggcgatggcctggagttcaag
aggcatttcctgaagatcaaggccaagctcagcgacattgtcagcacccagaaggtctgg
ctgcctggcacctga

DBGET integrated database retrieval system