KEGG   Geospiza fortis (medium ground-finch): 102039129
Entry
102039129         CDS       T03755                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic peptidase activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
gfr04210  Apoptosis
gfr05164  Influenza A
gfr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102039129 (APAF1)
   04115 p53 signaling pathway
    102039129 (APAF1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    102039129 (APAF1)
   05168 Herpes simplex virus 1 infection
    102039129 (APAF1)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD Ge1_WD40 eIF2A WD40_like CARD_2 Nup160 AAA_16 DUF2415 RAB3GAP2_N AAA_22
Other DBs
NCBI-GeneID: 102039129
NCBI-ProteinID: XP_005421670
UniProt: A0A6I9HJ13
LinkDB
Position
Un
AA seq 1249 aa
MDVKSRNYLLMNREALENDIKTSYIMDRMISDEVLTLQEEERVRQQNTRKERAAMLINII
LSKDNNSYRSFYNALLHEGYRDLAALLQDGIPSVSSGNRKSSMDGMNSYVKTILCEGGVP
QRPVVFVARPKLVDAIKKKLYCLGSNPGWVTVYGMAGCGKTVLTAEALRDPQLLEDYFPG
GVHWISVGKQDKAGLLIKLQNLCSRLEHDSTLSQRPPLNIEEAKDRLRLLMLRKYPRSLL
VLDDIWDSWVLKAFDNQCQVLITSRDRSVTDAVAGNKYEVHVGSGLAHEKGLEILSLFVN
MKISELPEQANSLVRECKGSPLVISLIGALLRDFPSRWEYYLRQLQNKQFRRIRKSSFYD
YEALDEAMSISVEQLDDNYKDYYKDLSVLPKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFHYYLHDLQLDFLTEKNRNQLQELHKNIVNQYKKYYKLNTPVLSQEDC
MYWYNFLAYHMAGAKMQQELRDLMFSLDWIKAKTELVGPAHLIHEYVEYSSALDQKDSTV
RENFQEFLSLNGHLLGRQPFPDIIQLGLCQPETSEVYQQAKLHAQRETGTFYLEWVNKKS
LKNLYRLVVRPHRDAVYHACFSKDRQRIASCGADKTLQVFKAESGERLLEINAHDDEILC
CAFSADGEFVATCSSDKKVKVWNSRTGQCRCVYEEHSEQVNCCQFNNKSGQYLLATCSND
TFIKIWDLNGKYCRNTMIGHENSVNHCRFSPNDEYVASCSTDGTVKLWEARSGNELKSIE
IKDFFKNADEQPDDVEVLVKCCSWSRNGNMILVAAKNKLLLFDINTCGLLTQVIVSHHST
IQYCDFCPGDELVAVALSHCSVELWNIKSLSKVAYCRGHMSWVHCVTFSPDGSLFLTSSD
DQTIRIWETKKVCQSSDAVLKSELDVVFHNGEVMILAIYNQKNLQLINGNTDNVIMQTAA
QESPISCCCLSEDLKFAAFGQESGTIKVLQLSDGKVLKSWEAYRTSVQHCQFTTDCQTLI
SSAHDSVIQIWNWQLSECVFLRGHKEAIKDFRLLENSKLLSWSFDGTVKVWNITTGNPEK
DFACHGGAVLSCAVSPDGSKFSSASADKTAKIWSFESSSVLHELKDHEACVRCCTFSPNN
KLLATGDDKGEIRIWDVLTGALLHFCSPVTVDEGEPTHGGWVTDLSFSPDSKMLVSSGGY
LKWWNVTTGESLQTFYTNGTNLKSIYVSPNFKVYVTVDNLGILYVLQKF
NT seq 3750 nt   +upstreamnt  +downstreamnt
atggatgtcaagagtagaaactatttgcttatgaatcgtgaagcactggaaaatgacatc
aagacttcttatattatggatcgtatgatttctgacgaagtactgacattacaggaggag
gagagagtgaggcaacagaatacccggaaggagcgagcagctatgctaataaacattatt
ctttcaaaagataataattcatatagatccttttataatgcactgctccatgaagggtac
agagatcttgctgcacttcttcaggatggcatcccttctgtctcgtctggtaacagaaag
agttcaatggatggaatgaattcctatgtgaagaccattctctgcgaagggggtgtgcca
cagagaccagttgtgtttgtcgctcgaccaaaactggtagatgctattaaaaagaaactg
tactgcttgggaagtaacccgggttgggtcacagtttatggaatggcaggctgtgggaag
actgttttaacagcagaagctttaagggatcctcagctcttggaagattattttccagga
ggagttcactggatctctgttgggaagcaggacaaagcagggctgctcataaaacttcag
aatctctgcagtagattggaacatgactccactctttcacaaaggccaccattgaacatt
gaggaggctaaagatcgtcttcgtttgctgatgttgcgcaaataccccaggtctcttttg
gtcctggatgacatttgggattcgtgggtgttaaaagcatttgataatcaatgtcaggta
ctgatcacaagcagggacaggagtgtaacagatgctgtggccggcaataaatacgaggtt
catgtgggaagtggactagcacatgagaaaggactggagattttatccctgtttgtgaat
atgaaaatatcagaacttccagaacaagctaactctcttgtaagagaatgcaaaggttct
cctctcgtgatatccttgataggtgctttactccgagacttcccgagccgctgggaatac
tatctcaggcagctgcagaataaacagtttagaagaataagaaaatcttccttctatgat
tacgaagcccttgatgaagcaatgtccataagtgttgagcagctggatgacaattacaaa
gattactataaagacctctctgtcctcccaaaagatgttaaagtacctactaaggttctc
tgtattctttgggatatggaaactgaagaagttgaagatatactacaggaatttgttaac
aaatcactgttgttctgtgatcgtaatgggaagtcattccattattatttacatgatctt
cagcttgactttctcacagagaagaaccgcaaccagcttcaggagttacataaaaacata
gtaaatcagtacaagaaatactacaagcttaatacacctgttctgtctcaagaggattgc
atgtactggtataactttctagcatatcacatggcaggtgccaaaatgcagcaggagctc
cgtgatcttatgttttctttagattggattaaagctaaaacagaattggtggggcctgct
cacctgattcatgaatatgtagaatatagttcagccctggatcaaaaggatagtacagtg
cgtgagaatttccaggagtttctgtccttaaatgggcaccttcttggccggcagccgttt
cctgacatcatccagttgggtctttgccagccagagacatcagaggtgtatcaacaagcc
aagctgcatgctcaaagggaaacaggaacattttatctggagtgggtaaataaaaaatcc
ttgaaaaatctctaccgtctggttgttcgcccgcatagagatgcagtttaccatgcctgc
ttttctaaggacagacaaagaatagcatcatgtggagctgataaaactcttcaggtgttt
aaagcagaaagtggagagagactcctagagataaatgcccacgatgatgaaatactctgt
tgcgctttttctgctgatggtgaatttgtagcaacttgttcaagtgataaaaaagtcaag
gtgtggaattcaagaacaggccagtgtaggtgtgtgtatgaagagcactctgagcaggtc
aattgctgccagttcaataacaaaagtggtcagtaccttctggccacctgctcaaatgac
actttcatcaaaatttgggatttgaatggaaaatactgtagaaataccatgataggtcat
gaaaattctgtcaatcactgcagattttcaccaaatgatgaatatgttgctagctgctcg
acagatggaacagtaaagctttgggaagcacgctcaggaaatgaactgaaaagcattgag
ataaaagatttctttaaaaatgcagatgaacaaccagatgatgtggaggttttagtaaaa
tgttgctcttggtccagaaatggtaacatgattttggtggcagccaaaaataagcttttg
ctttttgacatcaacacctgtggtttgttaactcaagtcattgtcagtcatcacagcaca
atccaatactgtgacttctgtcctggggatgaattagtagcagttgctttgtctcactgc
tcagttgagttatggaatattaagtctttatcaaaagtggcatattgcagaggacacatg
agctgggttcactgtgtgacattttcaccagatggatctttatttctgacttcatctgat
gaccagacaatacgtatctgggaaacaaagaaggtgtgccagtcttctgatgctgtgctg
aagagtgaactggatgttgtgtttcacaatggtgaagtgatgattttagccatctacaat
cagaagaatttacaacttatcaatggaaacacagacaacgttattatgcagacagcagct
caagaatcccccatttcctgctgttgcttaagtgaagatcttaaatttgcagcttttgga
caggagagtggaacaataaaggtactacagttatcagatgggaaggttctgaagtcctgg
gaggcctacaggacatctgtgcagcactgtcaatttacaaccgactgtcagactctcatc
tcaagtgctcatgattcagttatacagatatggaattggcaattgagtgaatgtgtgttc
ctaagagggcacaaggaagcaatcaaggattttagacttctggaaaattcaaaacttctc
tcttggtcattcgatggaaccgttaaggtttggaatatcactactggaaacccagaaaaa
gattttgcttgtcatggaggtgctgttctttcctgtgctgtttcacctgatggtagtaaa
ttttcatctgcttctgctgacaaaactgcaaagatatggagctttgaaagttcatctgtt
cttcatgaactgaaggaccatgaagcctgtgtgcggtgctgcactttctctcctaataac
aaactgctggccactggagatgacaaaggagaaataaggatttgggatgttttaacaggt
gcattacttcatttctgctccccagttactgtagatgaaggagagccaacacatgggggt
tgggtaacagacctctccttttctcctgacagtaaaatgcttgtgtcatctggaggctat
cttaagtggtggaatgtaactactggagaatccttacaaaccttctacacaaatggaaca
aacctcaagtcaatatatgtgtcccctaatttcaaagtatatgtgactgttgataatctt
ggcattctttatgtactacagaagttctga

DBGET integrated database retrieval system