KEGG   Geospiza fortis (medium ground-finch): 102039715
Entry
102039715         CDS       T03755                                 

Gene name
TSC2
Definition
(RefSeq) tuberous sclerosis 2
  KO
K07207  tuberous sclerosis 2
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
gfr04140  Autophagy - animal
gfr04150  mTOR signaling pathway
gfr04218  Cellular senescence
gfr04910  Insulin signaling pathway
gfr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    102039715 (TSC2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102039715 (TSC2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    102039715 (TSC2)
   04218 Cellular senescence
    102039715 (TSC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102039715 (TSC2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102039715 (TSC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gfr01009]
    102039715 (TSC2)
Protein phosphatases and associated proteins [BR:gfr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102039715 (TSC2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP Cnd1 Telomere_reg-2
Other DBs
NCBI-GeneID: 102039715
NCBI-ProteinID: XP_014164519
LinkDB
Position
Un
AA seq 1767 aa
MAKPQSKDSGLKEKFRNLLGLGTSRGSSKSSEGKQTEFIITAEILKELSIECGLSNRIRA
ISQICEVAKTKKIEEHAVEAVWKVVADMLQPERPAEARHAVLHLLKSIVQGQGERLGILR
AHFFKVIKDYPSNEDVHERLEVFKALTENGRYITYLEEELADFVLQWMDVGLTSEFLLVL
VNLVKFNSCYLEDYVADMVHKICLLCIQTSSSMDIEISLQVLDAVVCYNCLPSENLPVFI
ITLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCRIMEDRSYMADAALLRGAVFFVG
MALWGAHRLNSLRNSPTSVLPSFLKAMTCPNAVVSYEIVLSITRLIKKYGKGLQAVTWDI
LLDIMERLLQQLQVLESQELKSIVHDLLTTVEELCDQNDFHGSEERFFELVERCADQRPE
SSVLNLITYRAQSIHPAKDGWIHNLQLLMERFFRNESRSAVRIKVLDVLSFVLSINRQFY
EEELINLVVISQLAHIPEDKDHQVRKLATQLLVDLAEGCNTHHFNSLLDIIEKVAAHSLS
SPSELEERDLLSYSASLEDVKTAVLGLLIILQTKLYSLPSSHAMRVYEMLIQHVQRHYKY
CYSLPVASSIRLDSSVFPAAGVXLLMLRADSLHRLGLANKDGAVRFSPYCLCDFVEAEKR
ASEKKPPGTLSPPSGSPSVPSQGGTVRVGHLPYSMVFGVLLQCLKQETDWKVLKLVLNKL
PESLRYKVLFLTSPCNIDQLASALSYMLTDKKTTDRLHGTPEGFSRTDLHLAVVPVLTAL
ISYHNYLDKAKQREIVYCLEHGLIYRCANQCVVALSVCSVEMPDIIIKALPVLIVKLTHI
SATANMAIPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVI
AMWFIRCRLPFRKDFVPYITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRLAKNA
KQGLNNSPPVKELKEPSAVDAFRSRSISVSEHVVRSRIQTSITSSSLGSADENSMAQADD
NLKNLHLELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTITTSV
GTGTRSLLGLDSGEFQSTPESSSDPVLQVRQTKEAPAKLESQPGQQVCRSSRNRVRSMSG
GHALRVGALDSSASHFPSGSTSQGTQGPPAAAARPEKASPAPQTALQKEKANLAAYVPLL
TQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRETALY
KSLSVPSSSLATGTAKPSLLQRSNTESAVVLEEGSPGDMELREAESPAESPESEDVDTSC
SEHVLSEERFGKAQDSYSRSSSTSSQEEKSLRSEELSEGGIPIGREEGRALEELSFQPSQ
PLSKSSSSPELQTLQEVLKDANGREVPRRLSTEVKSKSQSGNLEGEGLGGWLGRGEDGRA
AGQGAGAAAATSPRSPSGHRPRGDTISDPDFSLLLSFSFVFLQLYHSPFFGDENNKPLLL
PNETFERSVQLLDQIPSYDTHKIAVLYVGEGQSNNEIAILSNEHGSYRYTEFLTGLGKLI
ELKDCQPDKIYLGGLDVCGEDGQFTYCWHDDIMQAIFHIATLMPTKDLDKYRCDKKRHLG
NDFVSIVYNDSGEDFKLGTIKGQFNFVHVIITPLDYDCNLVTLQCRKDMEGLVDTSVAKI
ISDKNLPFVARQMALHANMASQVHHSRSNPTDTYPSKWIARLRHIKRLRHRLREETQYQS
PGLPLQLHPSAPTNPPPQIPQDTPPSY
NT seq 5301 nt   +upstreamnt  +downstreamnt
atggcaaagcctcagagcaaggattccgggctgaaggagaagttcaggaacctcctgggg
ctgggaacatcccggggaagctccaagtcgtcggagggcaagcagacagagtttatcatc
actgcagaaatactcaaggaactgagcatagagtgtggactgagtaacaggatacgagca
atcagtcaaatttgtgaagtggcaaaaaccaaaaaaattgaagagcacgccgtggaggct
gtgtggaaggtggtggctgacatgctgcagcccgagcgtcccgccgaggccaggcacgcc
gtgctccacctgctcaagtccatcgtccagggacagggtgagaggctggggatcctcaga
gcccacttttttaaggttattaaggattatccctccaatgaagatgtgcatgagcggctg
gaagtgttcaaggctctgacggagaacgggcgctacatcacctacttggaggaggagctg
gcggattttgtgctgcagtggatggatgttgggctgacgtctgagttcctcctggttctg
gtgaacctggtgaaattcaatagctgctacctggaagactacgtagctgacatggtccac
aagatctgcctcttgtgcattcagacttcatcgtctatggacatagagatttccttgcaa
gtcctggatgcagttgtttgttacaactgcctgccctcggagaacctgcccgtgttcatc
atcaccctgtgccgcaccatcaacgtgaaggagctctgtgagccctgctggaagctcatg
cgcaacctcctgggaacccacctgggacacagtgccatctacaacatgtgcaggatcatg
gaagacagatcctacatggcagatgcagccctgctgagaggagctgtgttctttgttggg
atggctctgtggggggctcatcgcctcaattccctcaggaactcccccacttcagtgctg
ccttcattcctcaaggccatgacctgtcccaacgcagtcgtgtcctacgagatcgttctg
tccatcacacgcctgatcaagaaatatggcaaggggctgcaggctgtcacctgggatatc
ctcctggacatcatggagagactgctgcagcagctgcaggttctggagagccaagaactg
aagtccattgtacatgatcttctgaccacagtagaagagctctgtgaccagaatgatttt
catggctctgaagagagattttttgagctggtggaaagatgtgctgatcagagaccagaa
tcttctgtgttaaacctgataacgtacagagctcagtccatccaccctgccaaagatggc
tggatccacaacctgcagctcctaatggagagattcttcaggaacgagagccgtagtgct
gttaggattaaggttctggatgtgctgtcctttgtgctgagcatcaacagacagttctat
gaggaagagctgataaacctggtggtgatctcccagctggctcacatcccagaggacaaa
gaccatcaggtccgaaaattggccactcagctgctggtggacctggctgaaggctgcaac
actcaccacttcaacagcctgctggatatcatcgagaaggtggctgcacattctctgtca
tctccttctgagctggaagagagggaccttctgtcatattcagcttctctggaggatgtc
aagacagcagttcttgggctcctgataattcttcagaccaagctgtacagtttgccctcc
agccacgccatgcgcgtgtacgagatgctgatccagcacgtgcagcgccactacaagtac
tgctacagcctgcccgtggccagcagcatcaggcttgactccagtgtgttccctgctgct
ggtgtttgattgctgatgctccgagctgactccctgcaccgcctgggccttgccaacaag
gatggagcagtgaggttcagcccctactgcctctgtgactttgtagaggcagagaaaagg
gcttctgagaaaaagccccctggcaccctgtccccaccttcaggcagccccagtgtgcct
tcccagggtggcactgtccgggtgggacacctgccctactccatggtctttggggtcctc
ctgcagtgtttgaagcaggagacagactggaaggtgctgaagttggttctcaacaaatta
cccgagtctctccgctataaagtgctatttttaacttctccttgcaacatagaccagctg
gcctctgcactgagctacatgctcacagacaagaagaccacggacaggctccacgggacc
cccgaaggcttttcccgcacggatctgcacctggctgtggtccccgtgctgacagcgctg
atatcttaccacaactacctggacaaagccaagcagcgagagatcgtgtactgcctggag
cacgggctcatctaccgctgtgccaaccagtgcgtggtggcactgtcagtctgcagcgtg
gagatgcccgacatcatcatcaaggcactgcccgtcctaattgtcaaactcacccacatt
tctgccacggccaacatggcaatccctctgctggaatttctctcaactctggccaggctg
cctcacctgtaccggaacttcgcggcagagcagtacgccagcgtcttcgccatctccctg
ccctacaccaacccctccaagtttaaccagtacatcgtttgcctggcccaccacgtgatc
gccatgtggttcatccgctgccgcctgcccttccgcaaggactttgtcccctacatcacc
aagggcctgcgctccaacgtgctcctgtccttcgatgacaccccagagaaggacagcttc
agggctcgcagcaccagcctcaatgagaggccaaagagtttaagactagccaaaaatgca
aagcaaggcttgaataactctcctccagtgaaagagctgaaagaaccctctgcagttgat
gccttccgatcccgcagcatcagtgtgtctgaacatgtggtccgcagccgcatccaaacg
tccatcaccagctccagcctgggctctgcagatgaaaactccatggctcaggctgatgac
aacttgaaaaacctgcacctggagctgacagagacctgcctggacatgatggctcgatac
gtcttctccaacttcaccgctgtgcccaagaggtctcccgtgggggagtttctgctggct
ggaggaaggaccaagacctggctggttggtaacaagctggtgaccatcactacaagtgta
ggaacagggacaaggtccctgcttggcctggactctggagaattccagagcaccccagaa
tcaagctcagaccctgttttgcaagtgagacagaccaaggaggctccagccaagctggaa
tcccagcctgggcagcaggtttgcaggagctcccgcaacagagtccgatccatgtcgggt
ggtcatgccttacgtgttggtgccttagacagctcagcctcccattttcccagtggctca
acttcccaagggacgcagggccctcctgctgctgcagcccgcccagagaaggccagtcct
gctccacagacagccctgcagaaggaaaaagccaacttggctgcctacgtgccactgctg
acccagggctgggcagagatcctggtgcgcaggcccacaggcaacacgagctggctgatg
agcctggagaacccgctgagccccttctcctctgacatcaacaacatgcccctgcaggag
ctctccaacgccctgatggctgcagaacgcttcaaggagcaccgggagacggctctgtac
aaatccctgtccgtgccctcctccagcctggccacgggcacggccaagccctcgctgctg
cagcgctccaacacagaatcggccgtggtgctggaggagggcagcccgggcgacatggag
ctcagggaggccgagtcccccgccgagtcccccgagagcgaggacgtggacacctcgtgt
tctgagcacgtgctgagcgaggagaggtttggaaaagcccaggactcgtacagcaggtcc
tcctcgacgtccagccaggaggagaagtcgctgaggtcggaggagctgtcggagggcggg
atcccgatcgggcgtgaggagggccgggcgctggaggagctctccttccagccctcacag
cccctcagcaagtccagctcctccccggagctgcagacgctgcaggaggtgctcaaggac
gccaacgggcgggaggtgccgcggaggctgagcacggaagtgaaatccaaatcgcagtcg
gggaacctggaaggggaagggctgggcggctggctgggccgcggcgaggacggcagggcc
gccgggcagggcgctggcgccgcggctgccacctcgccccgctcgccctcgggccaccgg
ccgcggggcgacaccatctccgacccagacttctccctccttctctccttcagctttgtg
tttttacagttgtaccactcccccttctttggtgatgaaaacaacaaacccctcttgttg
ccaaatgagacatttgagaggtcagtgcagctcctggatcagatcccatcctatgacaca
cacaagattgcagtgctctacgttggggagggccagagcaacaacgagatcgccatcctg
tccaacgagcacggctcctaccgctacaccgagttcctcacgggcctgggcaagctcatc
gagctcaaggactgccagccagacaagatctacctgggtggcctggacgtttgtggggag
gatggacagttcacctactgctggcacgatgacatcatgcaagccattttccacattgct
actctgatgcccacgaaggatttggataaataccgctgtgacaagaagaggcacctgggg
aatgattttgtttccattgtttacaatgattctggagaggatttcaaactgggcacaata
aaggggcagttcaattttgtgcatgtgatcatcacccccctggactacgactgtaacctg
gtgacgctgcagtgccggaaagacatggagggtctggtggacacaagtgttgccaagatc
atctctgacaagaatctgcccttcgtggcccgtcagatggccctgcacgccaacatggct
tcccaggtccaccacagcagatccaaccccacggacacctacccctccaaatggatcgcg
aggctgcgccacatcaagaggctgcggcaccggctccgtgaagaaacacagtaccagagc
cctggccttcccctgcagctgcacccctctgcccccacaaacccccctccccagatcccc
caggacacccctcccagctat

DBGET integrated database retrieval system