KEGG   Geospiza fortis (medium ground-finch): 102039901Help
Entry
102039901         CDS       T03755                                 

Gene name
PTEN
Definition
(RefSeq) phosphatase and tensin homolog
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00562  Inositol phosphate metabolism
gfr01100  Metabolic pathways
gfr04068  FoxO signaling pathway
gfr04070  Phosphatidylinositol signaling system
gfr04115  p53 signaling pathway
gfr04140  Autophagy - animal
gfr04150  mTOR signaling pathway
gfr04218  Cellular senescence
gfr04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102039901 (PTEN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102039901 (PTEN)
   04070 Phosphatidylinositol signaling system
    102039901 (PTEN)
   04150 mTOR signaling pathway
    102039901 (PTEN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102039901 (PTEN)
  09143 Cell growth and death
   04115 p53 signaling pathway
    102039901 (PTEN)
   04218 Cellular senescence
    102039901 (PTEN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102039901 (PTEN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gfr01009]
    102039901 (PTEN)
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102039901 (PTEN)
    3.1.3.48  protein-tyrosine-phosphatase
     102039901 (PTEN)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     102039901 (PTEN)
Protein phosphatases and associated proteins [BR:gfr01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    102039901 (PTEN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 102039901
NCBI-ProteinID: XP_005430338
LinkDB All DBs
Position
Un
AA seq 369 aa AA seqDB search
MGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHN
PPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLRAQEALDF
YGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMFETIPMFSSGTCNPQ
FVVYQLKVKIFTSPSGPSRREDKYMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFW
VNTFFIGLDENSDKVENGSLVADQELDGIFSTERSDNDKEYLILTLTKNDLDKANKDKAN
RYFSPNFKVKLFFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDE
DQHTQITKV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgggctttcctgcagagaggcttgaaggagtgtaccggaacaacatcgatgatgtagta
aggtttttggattcaaagcataaaaaccattacaagatatacaatctatgtgctgaaaga
cattatgacaccgccaaatttaactgcagagttgcacagtacccttttgaagaccataac
ccaccacagctggagctcatcaaacctttttgtgaagatcttgaccagtggctaagtgaa
gatgacaatcatgtggcagcaatccactgtaaagctggaaagggacgaactggtgtaatg
atttgtgcttatttgttgcatcgaggcaagtttttaagggcccaagaagccctagatttc
tatggggaagtaaggaccagagacaagaagggagtgacaattcccagtcagagacgctac
gtgtactactatagctacctgttaaagaatcacctggattacagaccagtggcactgctg
ttccacaagatgatgtttgaaacaattcccatgttcagcagcggaacttgcaatcctcag
tttgtggtgtaccagctaaaggtaaagatattcacctccccttcaggaccctcacgacgt
gaagacaagtacatgtactttgaattcccccaacctctgcccgtatgtggtgatatcaaa
gtggaatttttccacaaacagaacaagatgttgaaaaaggacaaaatgtttcacttttgg
gtaaatacattcttcataggactggatgaaaattcagacaaagtagaaaatggaagtcta
gttgcagatcaggaactcgatggtattttcagtacagagcgctcagataatgataaggaa
tatttaatccttacattaacaaaaaacgatctagacaaagcaaataaagacaaagccaac
agatatttctctccaaacttcaaggtgaagctatttttcacaaaaacagtagaagagcca
tcaaatccagaggctagcagttcaacttctgtaacaccagatgttagtgacaatgaacct
gatcattatagatactctgacaccactgactctgatccagagaatgaaccttttgatgaa
gatcagcatacgcagattacaaaagtctga

DBGET integrated database retrieval system