KEGG   Geospiza fortis (medium ground-finch): 102039982Help
Entry
102039982         CDS       T03755                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04010  MAPK signaling pathway
gfr04020  Calcium signaling pathway
gfr04114  Oocyte meiosis
gfr04140  Autophagy - animal
gfr04261  Adrenergic signaling in cardiomyocytes
gfr04270  Vascular smooth muscle contraction
gfr04310  Wnt signaling pathway
gfr04340  Hedgehog signaling pathway
gfr04371  Apelin signaling pathway
gfr04530  Tight junction
gfr04540  Gap junction
gfr04910  Insulin signaling pathway
gfr04912  GnRH signaling pathway
gfr04914  Progesterone-mediated oocyte maturation
gfr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102039982 (PRKACB)
   04310 Wnt signaling pathway
    102039982 (PRKACB)
   04340 Hedgehog signaling pathway
    102039982 (PRKACB)
   04371 Apelin signaling pathway
    102039982 (PRKACB)
   04020 Calcium signaling pathway
    102039982 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102039982 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102039982 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102039982 (PRKACB)
   04540 Gap junction
    102039982 (PRKACB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102039982 (PRKACB)
   04912 GnRH signaling pathway
    102039982 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    102039982 (PRKACB)
   04916 Melanogenesis
    102039982 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102039982 (PRKACB)
   04270 Vascular smooth muscle contraction
    102039982 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gfr01001]
    102039982 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gfr03019]
    102039982 (PRKACB)
   03036 Chromosome and associated proteins [BR:gfr03036]
    102039982 (PRKACB)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     102039982 (PRKACB)
Protein kinases [BR:gfr01001]
 Serine/threonine kinases: AGC group
  PKA family
   102039982 (PRKACB)
Messenger RNA biogenesis [BR:gfr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102039982 (PRKACB)
Chromosome and associated proteins [BR:gfr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102039982 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 102039982
NCBI-ProteinID: XP_005422095
LinkDB All DBs
Position
Un
AA seq 396 aa AA seqDB search
MAGHKEVPCSQGTATALQRLEGFANRLFHRHSKNGAHEQRAALENESQQCSEYTVQWDAS
MKEFLAKAKEDFLRKWESPPQNTAGLDDFERQKTLGTGSFGRVMMVKHKSTEQYYAMKIL
DKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLRR
IGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGR
TWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGK
VRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPF
IPKCRGPGDTSNFDDYEEEDIRASLTEKCAKEFADF
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcagggcacaaggaggtcccttgcagccagggcacggccacagcgctgcagagactg
gaagggtttgctaaccgcctcttccataggcactccaagaatggtgcgcatgagcagaga
gcggctctggaaaatgagagccagcagtgctctgagtacactgtccagtgggatgcatca
atgaaagagttcctagccaaagccaaagaagactttttaagaaaatgggaaagcccccct
cagaatactgctggcctagatgattttgagcggcaaaaaacccttggaacaggatcattt
gggagagtaatgatggtgaaacataaatccacagaacagtattatgctatgaagatactg
gacaaacagaaggtcgtcaaactgaagcagatagaacacacactgaatgagaagaggata
ttacaagcagtgaactttcctttccttgttaaactggagtattcttttaaggacaattct
aatttatacatggtaatggagtatgttcctgggggagaaatgttttcacatctaagaaga
atcggaaggttcagtgagccacatgcacggttttatgcagctcagatagtgctaacattt
gagtacctccattcattagacctcatctacagagatctaaagcctgaaaatcttttaatt
gatcagcaaggatacatccaggtcacggactttggctttgcaaaaagagtaaaaggcaga
acttggacgttatgtgggactccagaatacctggcacctgaaataattctcagcaagggt
tacaacaaggcagtggattggtgggcactaggagtgttaatctatgaaatggcagctgga
tatcccccattctttgcagatcaacccattcaaatttacgagaagattgtgtctggcaag
gtgaggttcccatcacacttcagttcagacctaaaggatcttctaagaaatttactccag
gtagatttgaccaaaagatatggaaatctcaagaatggtgtaaatgacataaagaatcac
aagtggtttgcaactacagattggattgccatttatcagagaaaggtagaagctccattc
ataccaaagtgcagaggtcctggagataccagcaactttgatgactatgaagaagaagat
attcgtgcttctctaacagaaaaatgtgcaaaagaatttgctgatttttag

DBGET integrated database retrieval system