KEGG   Geospiza fortis (medium ground-finch): 102040458
Entry
102040458         CDS       T03755                                 

Gene name
SIAH1
Definition
(RefSeq) siah E3 ubiquitin protein ligase 1
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
gfr04120  Ubiquitin mediated proteolysis
gfr04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102040458 (SIAH1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102040458 (SIAH1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102040458 (SIAH1)
Enzymes [BR:gfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102040458 (SIAH1)
Ubiquitin system [BR:gfr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    102040458 (SIAH1)
SSDB
Motif
Pfam: Sina
Other DBs
NCBI-GeneID: 102040458
NCBI-ProteinID: XP_005426495
UniProt: A0A6I9HNS9
LinkDB
Position
Un
AA seq 313 aa
MTGRSASSGPYSWKGVWSACLPGSKTCKGKEMSRQTATALPTGTSKCTPSQRVPALTGTT
ASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEK
VANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLM
HQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIV
QLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAE
NGNLGINVTISMC
NT seq 942 nt   +upstreamnt  +downstreamnt
atgacgggcagatccgcctccagcgggccgtactcctggaagggcgtctggtctgcgtgc
ttgccggggagtaaaacctgcaagggaaaagaaatgagccgtcagaccgctacagcacta
cccacaggtacctccaagtgcacgccatcgcagagggtgcccgcgctgacgggcaccaca
gcctccaacaatgacttggccagtctctttgagtgtcccgtgtgctttgactatgtgctg
ccacccatcctgcagtgtcagagtggccacctggtctgtagcaactgtcgccccaagctc
acgtgctgccccacttgccgaggcccgctgggctccatccgtaacctggccatggagaaa
gttgccaattccgtactattcccgtgtaaatacgcctcttccggctgcgagataactttg
ccacacacagaaaaagcagaccacgaggagctgtgtgagtttaggccttactcctgtccc
tgtcctggtgcttcgtgtaaatggcaaggctctctggatgctgtaatgccgcacctgatg
catcagcataagtcaattacgacgctgcagggagaagatatagtgttcctggccacggac
attaatcttcctggtgctgttgactgggttatgatgcagtcttgttttggctttcatttc
atgctagtgttggagaaacaggaaaagtatgatggtcaccagcagttctttgcaattgta
cagctgataggaacgcgcaagcaagcagaaaactttgcttatcgactcgagctaaacggg
cataggcggcgattgacttgggaagcaactcctcgatccattcatgagggaattgcaaca
gccattatgaatagtgactgtctagtctttgacaccagcattgcacagctctttgcagaa
aatggcaatttaggcatcaacgtaactatatccatgtgttga

DBGET integrated database retrieval system