KEGG   Geospiza fortis (medium ground-finch): 102040558
Entry
102040558         CDS       T03755                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04010  MAPK signaling pathway
gfr04060  Cytokine-cytokine receptor interaction
gfr04068  FoxO signaling pathway
gfr04144  Endocytosis
gfr04218  Cellular senescence
gfr04350  TGF-beta signaling pathway
gfr04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102040558 (TGFBR2)
   04350 TGF-beta signaling pathway
    102040558 (TGFBR2)
   04068 FoxO signaling pathway
    102040558 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102040558 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102040558 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    102040558 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102040558 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gfr01001]
    102040558 (TGFBR2)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102040558 (TGFBR2)
Protein kinases [BR:gfr01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   102040558 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 102040558
NCBI-ProteinID: XP_014163454
UniProt: A0A6I9ZAM8
LinkDB
Position
Un
AA seq 521 aa
MSNLCKFCDIKVTTCSNQHRCRSNCNITSICEKSSEVCVAIWRQNDENMTLETICHDPKE
TLYGHFLDDYPSEQCLMKEKKADGGLMFMCSCTGEECNDMLIFTSDDPHKPEEKDEISKV
TIISLVPLLVISVAVIVIFYAYRTHKKRKLSKAWEKNVKPKKHKDCSDGCAIMLDDDRSD
ISSTCANNINHNTELLPIELDVVVGKGRFAEVYKAKLKQNTSEQYETVAVKIFSYEEYAS
WKTEKDIFSDVNLKHENILQFLTAEERKTDLGKQYWLITAFHAKGNLQEYLTRHIISWED
LWKLGGSLARGIAHLHSDHTPCGRPKTPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDP
SLSVDDLANSGQVGTARYMAPEVLESRMNLENMESFKQTDVYSMALVLWEMTSRCNAVGE
VKEYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSSWLNHQGIQMVCETLIECWDHDPE
ARLTAQCVAERFSELRHHDRLSGRSCSEEKIPEDGSVTTAK
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtcaaacttatgcaagttttgtgatattaaagtaacaacctgctcaaaccaacatcgg
tgcaggagtaactgcaacatcacttctatctgtgagaagagtagtgaagtctgtgttgct
atatggagacagaatgatgaaaatatgacattagaaacaatatgccatgatcccaaggaa
acactgtatggtcactttttggatgactatccatcagagcagtgtttgatgaaggaaaag
aaggctgatgggggattgatgttcatgtgttcctgcacaggtgaagaatgcaacgatatg
ctcatttttacatcagatgacccccataagccagaggagaaagatgaaatttccaaagtc
acaatcataagtcttgtcccgttactggtgatttctgttgctgtgattgttatcttttat
gcctaccgcactcacaagaagaggaaactcagcaaggcatgggagaagaatgttaagccc
aagaagcataaggactgcagtgatggctgtgccattatgttagatgacgaccgctcagac
atcagctccacgtgtgccaacaacatcaaccacaacacagagctgctgcccattgagttg
gacgttgttgttggcaaaggaaggtttgctgaagtgtataaagccaaattgaagcaaaac
acatcagaacagtatgaaactgtggcagtcaagattttctcctacgaagaatacgcttcc
tggaaaactgagaaagacatattttcagatgtaaacctcaagcatgagaacatactccag
ttcttgacagcagaggaacgtaagacagaccttggcaaacagtattggttgatcactgcc
ttccatgctaaaggaaacttgcaggagtatctcacacggcacattatcagctgggaggac
ctctggaaacttggcgggtccttggcccgagggattgcccatctgcacagtgatcacaca
ccctgtggtcgtcccaaaacacctatcgtacacagggacctaaagagttccaacatcctg
gtgaaaaatgatttaacctgctgtctctgtgactttgggttgtccctgaggctggaccct
tccctgtctgtggatgacttggctaacagtgggcaggttggcacagcgagatatatggcc
cctgaggttttggagtccaggatgaacctggagaacatggagtccttcaaacaaacagat
gtgtactccatggctttggtcctctgggaaatgacatctcgctgtaacgctgtcggagaa
gtgaaagagtacgagcccccattcggctccaaagtgcgagaacacccttgtgtggaaagc
atgaaggacaatgtcctgagagacagagggcgacccgagatccccagctcctggcttaac
catcagggcatccagatggtgtgtgagacgctcatcgagtgctgggaccacgaccccgag
gcacggctgacggcgcagtgcgtggccgagcgcttcagcgagctcaggcaccacgacagg
ctctcggggaggagctgctccgaggagaagattcccgaggacggctccgtgaccaccgcc
aagtag

DBGET integrated database retrieval system