KEGG   Geospiza fortis (medium ground-finch): 102040569
Entry
102040569         CDS       T03755                                 

Gene name
CCNE1
Definition
(RefSeq) cyclin E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04110  Cell cycle
gfr04114  Oocyte meiosis
gfr04115  p53 signaling pathway
gfr04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102040569 (CCNE1)
   04114 Oocyte meiosis
    102040569 (CCNE1)
   04115 p53 signaling pathway
    102040569 (CCNE1)
   04218 Cellular senescence
    102040569 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gfr03032]
    102040569 (CCNE1)
   03036 Chromosome and associated proteins [BR:gfr03036]
    102040569 (CCNE1)
DNA replication proteins [BR:gfr03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102040569 (CCNE1)
Chromosome and associated proteins [BR:gfr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102040569 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102040569
NCBI-ProteinID: XP_005426325
LinkDB
Position
Un
AA seq 418 aa
MGTVLSPVSALLAGLISQAPGVELFPAFLKRGAPKLTAPHEGPGVAFLQDPDEEIAKMEM
TRKKPCEKQKSWTNIHEHAHMLIPTPDKDDDPVRVDYSRFIHLSVVPTRATPLPALGWAN
KDDVWKNMINKEETYVRDKFYMQRHPQLQPKMRTILLDWLMEVCEAYKLHRETFYLAQDF
FDRFMATQQDVVKTLLQLIGVTSLFIAAKLEEIYPPKLHQFAYVTDGACTEDEIISMELI
IMKALNWNLNPLTVVSWLNIYLQVAYLNDLYEVMLPQYPQQIFVQITELLDLCVLDIGCL
EYTYGILAASALYHFSSSELMQKVSGYEFCEIEDCVKWMVPFAMALREVGSSKLKHFSGI
APEDLHNIQTHINSFDLLDRAQAKQAILAEQNRTSPFPTGVLTPPQSSKKLSSGLQSI
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggggactgtgctgagccctgtgtcagctctgttagctggcctgatttctcaggctccc
ggtgtggaactgtttcccgcctttttgaaacggggagcgcccaaactgacggcgcctcat
gaggggcccggggtggcgttcttacaggatcctgatgaagaaattgccaaaatggagatg
actagaaaaaagccgtgcgaaaaacagaagtcctggactaacatccacgagcatgcccac
atgctgattcccactccagacaaagacgacgatcccgtccgtgtcgattactcgcgcttt
atccacctgagcgttgttcccaccagagcaaccccactgccagctctaggctgggcaaac
aaggatgatgtatggaaaaacatgataaacaaagaagagacctacgtgagggataaattc
tacatgcaaaggcacccccagctgcagcccaagatgagaaccatccttctagactggcta
atggaggtttgtgaagcctacaaacttcatagagaaactttttatttagcacaagatttc
tttgatcgctttatggccacacaacaggatgttgtaaaaacactattgcagcttattggt
gtcacttctctgttcatagcagcaaagcttgaggaaatttatccaccgaagctacaccag
tttgcctatgttacagatggagcctgtacagaagatgaaatcatcagtatggaattgatc
attatgaaggctcttaattggaacttaaatccactgacagttgtatcgtggctaaacatt
tacctgcaagttgcatatttaaatgatctttatgaagtaatgctgccacaatatccacag
cagatatttgtacaaataacagagctcttggatctctgtgtgctggatattggctgcttg
gaatatacctatggaatacttgcagcttctgctttgtatcacttctcttcatctgagctg
atgcagaaagtttcaggttatgagttctgtgagatagaggactgtgtgaaatggatggtc
ccatttgccatggctctgagggaagtaggaagctccaaactcaaacactttagcgggata
gctcctgaagatttgcacaatatacagacacacatcaacagctttgatttgctggacaga
gctcaagcaaaacaagccatattggctgagcaaaataggacttcacctttccccactggt
gtccttacaccaccacaaagtagtaagaaactgtcttctggactgcaatcaatctga

KEGG   Geospiza fortis (medium ground-finch): 102043017
Entry
102043017         CDS       T03755                                 

Gene name
CCNE2
Definition
(RefSeq) cyclin E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04110  Cell cycle
gfr04114  Oocyte meiosis
gfr04115  p53 signaling pathway
gfr04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102043017 (CCNE2)
   04114 Oocyte meiosis
    102043017 (CCNE2)
   04115 p53 signaling pathway
    102043017 (CCNE2)
   04218 Cellular senescence
    102043017 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gfr03032]
    102043017 (CCNE2)
   03036 Chromosome and associated proteins [BR:gfr03036]
    102043017 (CCNE2)
DNA replication proteins [BR:gfr03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102043017 (CCNE2)
Chromosome and associated proteins [BR:gfr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102043017 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102043017
NCBI-ProteinID: XP_005422959
UniProt: A0A6I9HJK8
LinkDB
Position
Un
AA seq 405 aa
MSRRSSRLQAKQQQPLSCPEEAPQELQALDYLQTRKRRTAEQEIKKREDGKIAKKHQYEI
QSCWPPTITGGISPCIIIETPHKESVTTDFSRFKKYRFRNLFINPSPLPELNWGNSKDVW
LNILTKENRYAHCKHFTSLHSSLQPHMRSILLDWLLEVCEVYALHRETFYLAQDFFDRFM
LTQKNINKSMLQLIGITSLFIASKLEEIYAPKIQEFAYVTDGACSEEDIVRMELIMLKAL
KWELCPVTIVSWLNLYLQVDALKDVPKVLLPQYSQEKFIQIAQLLDLCILDVNSLDFQYR
TLAAAALCHYTSIEIVKKASGLDWDSISECVQWMVPFVNVAKKVPVKLKNFKKVAAEDRH
NIQTHTNYLDMLEEVNSAVVSTAPGQLSPVSTGGIITPPKSTEKK
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgtcaaggcgcagtagccgtttgcaagccaaacagcagcagccactgtcctgtccagaa
gaggctccacaagagctgcaagcactagattatctccagaccagaaaaaggagaacagca
gagcaggaaattaagaaaagagaagatggaaaaattgcaaaaaaacatcaatatgaaatt
cagagttgttggccccccacgataacaggaggcatctcgccttgcataattattgaaaca
cctcacaaagaatcagtaaccactgacttctcgagattcaaaaaatacagattcaggaac
ctcttcataaatccatcacctttgccagaactcaactggggcaattccaaagatgtctgg
ctcaacatcctgacgaaggaaaacagatatgctcactgcaaacacttcacatcactacat
tctagtttgcaacctcacatgagatccatactgctagactggctcttagaggtgtgtgag
gtgtatgcactccaccgggaaaccttctacctagctcaagacttctttgacagattcatg
ttgacacaaaagaacattaacaagagcatgcttcagctcataggaattacctcattattt
attgcctccaaacttgaggaaatatacgctcctaaaatacaggaatttgcttacgtcact
gatggtgcttgcagtgaagaagatattgtaagaatggaacttattatgttaaaggcttta
aaatgggaactctgtccagtgacaattgtctcttggctgaacctctatcttcaagtggat
gctctgaaggatgttccaaaagtactgctacctcagtattctcaggaaaaattcattcaa
atagcccagcttttagacctgtgtattctggatgtgaattctttggacttccagtacaga
acactagccgctgcagcgctctgccactatacctcaatcgaaatagttaagaaagcttca
ggcttagattgggacagcatttcagagtgtgtacaatggatggttccttttgtcaatgtg
gcaaaaaaggtccctgtgaagctgaagaacttcaagaaggttgcagcggaagatcgacac
aatatccagacccacacaaattatctggacatgctggaagaagtgaacagtgcagtagtg
tctactgccccagggcagctatcacctgtgtcaacaggaggaataataacccctcccaaa
agcacagagaagaaatga

DBGET integrated database retrieval system