KEGG   Geospiza fortis (medium ground-finch): 102040735
Entry
102040735         CDS       T03755                                 

Gene name
IGFBP3
Definition
(RefSeq) insulin like growth factor binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
gfr04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102040735 (IGFBP3)
   04218 Cellular senescence
    102040735 (IGFBP3)
Membrane trafficking [BR:gfr04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    102040735 (IGFBP3)
Exosome [BR:gfr04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102040735 (IGFBP3)
SSDB
Motif
Pfam: Thyroglobulin_1 DUF4829
Other DBs
NCBI-GeneID: 102040735
NCBI-ProteinID: XP_005427325
UniProt: A0A6I9HRN0
LinkDB
Position
Un
AA seq 162 aa
GPHAAGNFSDSEEDRSTSSIENQAIPNSHRVPDSKSHPPHIKIDIIRKVQAKDTQRYKVE
YDSQSTDTLNFSSESKQETEYGPCRREMEDTLNHLKILNVLSPRGFHIPNCDKKGFYKKK
QCRPSKGRKRGYCWCVDKYGQPLPGYDGKGKGDVHCYNLESK
NT seq 489 nt   +upstreamnt  +downstreamnt
ggaccacacgctgcaggaaatttcagtgattcagaagaagacaggagtaccagcagcata
gaaaatcaggccattccaaactctcacagggtgccagattccaagtcacatccaccacac
atcaaaatagatatcatcaggaaagtgcaagccaaagatacacaacgctataaagttgaa
tatgattcgcagagtacggatacattgaatttctcttctgaatccaaacaagagactgaa
tatggtccatgtcgtagagaaatggaagacactttaaaccacctaaagatcctgaatgtc
ttgagtcccaggggctttcatattccaaattgtgacaagaagggattctacaagaaaaag
caatgtcgcccatccaaaggccgaaaaagaggttattgctggtgtgtggataaatatgga
cagccacttcctgggtatgatgggaagggaaaaggagatgtccactgctataacttggaa
agcaaatga

DBGET integrated database retrieval system