KEGG   Geospiza fortis (medium ground-finch): 102041135
Entry
102041135         CDS       T03755                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04012  ErbB signaling pathway
gfr04068  FoxO signaling pathway
gfr04110  Cell cycle
gfr04115  p53 signaling pathway
gfr04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102041135 (CDKN1A)
   04068 FoxO signaling pathway
    102041135 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102041135 (CDKN1A)
   04115 p53 signaling pathway
    102041135 (CDKN1A)
   04218 Cellular senescence
    102041135 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102041135
NCBI-ProteinID: XP_005428168
UniProt: A0A6I9HSJ0
LinkDB
Position
Un
AA seq 151 aa
MPLSQSRAGQSPCSSKACRNLFGPVDHEQLQQDFEDQMKQQLEEAQQRWNFNFETETPLE
GPFKWERVLVAEQAPHEVHSLVRAVISSDSRSSLAHRVPPKERVGRICPEEAQQSSKVCR
AGSLQGLKRGQTTIKDFYSAKRRIVPARPRP
NT seq 456 nt   +upstreamnt  +downstreamnt
atgccgctgtcccagagccgggctgggcagagcccctgcagcagcaaggcctgcaggaac
ctctttggccccgtggaccacgagcagctccagcaggactttgaggaccagatgaaacaa
cagctggaagaagctcagcagcgctggaacttcaactttgagacagagactcccctggaa
gggcccttcaagtgggagagggtgctggtggctgagcaggcaccccacgaggttcacagc
ctggtcagggctgtcatcagcagtgacagcaggagctccctggcccacagggtccccccc
aaggagcgtgttggcaggatttgccccgaggaggctcagcagagctcgaaggtttgcagg
gctggttccctgcagggcttgaaacgtgggcagaccacgatcaaagacttctacagtgcc
aagaggaggatcgtccctgcccggccccggccgtga

DBGET integrated database retrieval system