KEGG   Geospiza fortis (medium ground-finch): 102041363
Entry
102041363         CDS       T03755                                 

Gene name
RCHY1
Definition
(RefSeq) ring finger and CHY zinc finger domain containing 1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
gfr04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102041363 (RCHY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102041363 (RCHY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gfr04121]
    102041363 (RCHY1)
Enzymes [BR:gfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102041363 (RCHY1)
Ubiquitin system [BR:gfr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    102041363 (RCHY1)
SSDB
Motif
Pfam: zinc_ribbon_6 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_5 zf-RING_UBOX Prok-RING_4 zf-C3HC4_3 zf-RING_11 zf-CHY
Other DBs
NCBI-GeneID: 102041363
NCBI-ProteinID: XP_014165936
LinkDB
Position
Un
AA seq 193 aa
MQAQQRCEGCGSLFGEYYCDICHLFDRDKKQYHCQECGICRIGPKEDFFHCSKCNLCLSL
SLQGKHKCIENVSRQDCPICLEDIHTSRVGAHVLPCGHLLHRTCYDEMLKEGYRCPLCMH
SALDMTRYWRQLDNEVAQTPMPTEYQNMMVEILCNDCNARSTVQFHLLGMKCQSCESYNT
AQDGRCRLSLEEQ
NT seq 582 nt   +upstreamnt  +downstreamnt
atgcaggcccagcagcgctgtgagggctgtggcagcctctttggagagtactactgtgat
atctgccacctgtttgaccgtgacaagaagcagtaccactgccaggagtgtggcatctgc
aggattggccccaaggaggatttcttccactgctccaagtgtaatttgtgcctgagcctg
agtctccaaggaaagcacaagtgtattgaaaatgtctccaggcaggactgtccaatatgt
ttggaggatattcacacatctcgtgttggagcccacgttctgccgtgtggtcaccttctt
cacagaacatgttacgatgaaatgctgaaggaaggctacaggtgtcccttgtgcatgcac
tcggccttggacatgaccaggtactggcgccagctggacaacgaggtggcacagactccc
atgcccaccgagtaccagaacatgatggtggagatcctttgcaacgactgcaacgcccgc
tccacggtgcagttccacctgctgggcatgaagtgccagagctgtgagtcctacaacacg
gcccaggacgggcggtgccggctgtccttggaggagcagtga

DBGET integrated database retrieval system