KEGG   Geospiza fortis (medium ground-finch): 102041787
Entry
102041787         CDS       T03755                                 

Gene name
MDM2
Definition
(RefSeq) MDM2 proto-oncogene
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04068  FoxO signaling pathway
gfr04110  Cell cycle
gfr04115  p53 signaling pathway
gfr04120  Ubiquitin mediated proteolysis
gfr04144  Endocytosis
gfr04218  Cellular senescence
gfr04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102041787 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102041787 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102041787 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    102041787 (MDM2)
   04115 p53 signaling pathway
    102041787 (MDM2)
   04218 Cellular senescence
    102041787 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102041787 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gfr04131]
    102041787 (MDM2)
   04121 Ubiquitin system [BR:gfr04121]
    102041787 (MDM2)
Enzymes [BR:gfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102041787 (MDM2)
Membrane trafficking [BR:gfr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    102041787 (MDM2)
Ubiquitin system [BR:gfr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    102041787 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS DZR
Other DBs
NCBI-GeneID: 102041787
NCBI-ProteinID: XP_005419280
UniProt: A0A6I9HFT8
LinkDB
Position
Un
AA seq 483 aa
MCNTKMSSLTDPSVTASEQEALVKPKPLLLKLLKLAGAEKDTFTMKEVIFYIGQYIMSKQ
LYDEKQQHIVHCANDLLGELFGVTSFSVKEHRRLYSMISRNLIAINQQDSTLGDAPEDDA
TSQLEEENVVKESRQELEESQTSSSVTSRPTTSSRRRTHSESEKSSPDDLHSDRRKRHKS
ENISVTFDESLSWCVVSGLCRERSNSSDSTDSLSIPDLDASSLSENSDWFDHGSVSDQFS
VEFEVESVYSEDYSHNEEGQELTDEDDEVYQLTIYQDEDSDADSFDEDPEISLADYWKCP
ECSEMNPPLPRHCHRCWALREDWLPDEKSEKLEKSKLETSFPAESGEGFDVPDCKKTKMT
EDKEPAVDENEDKAVQLSESQESEGYSQPSTSSSMFCSSQEDFKEPEKREMQDKEESMES
SLPVTSIEPCVICQSRPKNGCIVHGKTGHLMSCFTCAKKLKKRNKPCPVCRQPIQMIVLT
YFS
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgtgcaataccaagatgtcctcccttacggatccctctgtcaccgcttcggagcaagag
gcgctggttaaaccaaagccactgttgttaaaattgttaaagttagctggtgctgaaaag
gacacttttactatgaaggaggtaatattctatattggacaatatattatgtctaagcaa
ttatatgatgaaaaacagcagcatattgtacactgtgcaaatgatctcctgggggagtta
tttggagtaacaagcttttcagtaaaagaacacaggagactatattcaatgatttccaga
aatctgatagcaatcaatcaacaagactctacccttggcgacgcacctgaggatgatgcc
acatctcagcttgaagaagaaaatgttgttaaggaatctaggcaagagttagaagagagc
cagacttcatcaagtgtgacttcccgaccaactacatcttctaggaggaggacacacagt
gaatctgaaaaaagttctccagatgacctgcacagtgacagaagaaagcgacacaagtca
gagaacatttcggtgacgtttgatgaaagtctctcttggtgtgtagtcagtggtctgtgc
cgtgaaagaagcaatagcagtgattcaacagattctctttccatccctgatcttgatgct
agttcattaagcgaaaactcagattggtttgaccatggttctgtatcagaccagttcagt
gtggagtttgaagttgagtctgtttattcagaagattatagccataatgaagaagggcag
gagctcactgatgaagatgatgaggtttatcagctgactatttaccaggatgaagatagt
gatgctgattcatttgatgaagatccagagatttctctagctgattattggaagtgtccc
gaatgcagtgaaatgaatcctccgcttccacgacattgccacagatgctgggcccttcgt
gaggattggcttcccgatgaaaagagtgagaaattggaaaagagcaaattagaaacctcc
tttcctgcagagtctggagaaggttttgatgttcctgactgcaagaaaacaaaaatgact
gaagataaagaaccagctgtagatgagaatgaggataaagcagtacagctttctgagtcc
caggaaagtgaaggttattcccagccatcaacatcaagcagcatgttctgtagcagtcag
gaggacttcaaggaacctgagaagagagaaatgcaagacaaagaggaaagcatggaatcc
agtctgcctgttaccagcatagagccgtgtgtcatatgtcagagcagacctaaaaatggc
tgcatagtacacggcaaaacgggacacctcatgtcatgctttacctgtgcaaaaaagctc
aagaagaggaacaagccctgcccagtgtgcaggcagcccatacaaatgattgtactaact
tattttagttag

DBGET integrated database retrieval system