Geospiza fortis (medium ground-finch): 102042101 Help Entry 102042101         CDS       T03755                                  Symbol PPIA Name (RefSeq) peptidylprolyl isomerase A   KO K03767   peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC:5.2.1.8] Organism gfr  Geospiza fortis (medium ground-finch) Pathway gfr03250   Viral life cycle - HIV-1 gfr04217   Necroptosis Brite KEGG Orthology (KO) [BR:gfr00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     102042101 (PPIA)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102042101 (PPIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:gfr03110]     102042101 (PPIA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gfr04147]     102042101 (PPIA) Enzymes [BR:gfr01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      102042101 (PPIA) Chaperones and folding catalysts [BR:gfr03110]  Protein folding catalysts   Peptidyl prolyl isomerase    Cyclophilin     102042101 (PPIA) Exosome [BR:gfr04147]  Exosomal proteins   Proteins found in most exosomes    102042101 (PPIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pro_isomerase Motif Other DBs NCBI-GeneID:  102042101 NCBI-ProteinID:  XP_005430819 UniProt:  A0A6I9HT31 LinkDB All DBs Position Un AA seq 149 aa AA seqDB search MPFLSLQLFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGK SIYGEKFPDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGRVKEGM NVVEAMERCGSKDGKTSKKITITDCGQLS NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgcctttcctgtctttacagctctttgcagacaaggtgccgaagacagcagaaaacttc cgtgctctgagcactggtgagaagggattcggctacaaggggtcctgcttccacagaatc attcctgggttcatgtgccagggtggtgacttcacacgccacaatggcactggaggcaaa tccatctatggggagaagttcccagatgagaacttcatcctgaagcacacgggtcctggt atcctgtcgatggccaatgccggccccaacacgaacggttcccagttcttcatctgcact gccaagaccgagtggctggatggcaagcacgtcgtcttcggccgtgtcaaggaggggatg aatgtggtggaggccatggagcgctgcggctccaaagatggcaaaacaagcaagaagatc accatcaccgactgcgggcagctctcgtaa

DBGET integrated database retrieval system