KEGG   Geospiza fortis (medium ground-finch): 102042249Help
Entry
102042249         CDS       T03755                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00010  Glycolysis / Gluconeogenesis
gfr00053  Ascorbate and aldarate metabolism
gfr00071  Fatty acid degradation
gfr00260  Glycine, serine and threonine metabolism
gfr00280  Valine, leucine and isoleucine degradation
gfr00310  Lysine degradation
gfr00330  Arginine and proline metabolism
gfr00340  Histidine metabolism
gfr00380  Tryptophan metabolism
gfr00410  beta-Alanine metabolism
gfr00561  Glycerolipid metabolism
gfr00620  Pyruvate metabolism
gfr01100  Metabolic pathways
Module
gfr_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102042249 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    102042249 (ALDH7A1)
   00620 Pyruvate metabolism
    102042249 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102042249 (ALDH7A1)
   00561 Glycerolipid metabolism
    102042249 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102042249 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    102042249 (ALDH7A1)
   00310 Lysine degradation
    102042249 (ALDH7A1)
   00330 Arginine and proline metabolism
    102042249 (ALDH7A1)
   00340 Histidine metabolism
    102042249 (ALDH7A1)
   00380 Tryptophan metabolism
    102042249 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102042249 (ALDH7A1)
Enzymes [BR:gfr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102042249 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     102042249 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     102042249 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-GeneID: 102042249
NCBI-ProteinID: XP_014164608
LinkDB All DBs
Position
Un
AA seq 510 aa AA seqDB search
MSFETFIGEFVHWRVRSFKQANQQAPLEHYITRQDIGSPCHFRFRVTPPTSPDGNLEDYE
ETVKKAKEAWKVWADIPAPKRGEIVRQIGDALRQKIKVLGSLVSLEMGKIFVEGVGEVQE
YVDVCDYAVGLSRMIGGPILPSERPGHALIEQWNPVGLVGVITAFNFPVAVYGWNSAIAM
ICGNACLWKGAPTTSLVSVAVTKIIAKVLEDNKLPGAICSLVCGGADIGTAMARDERMDL
LSFTGSTKVGKQVALMVQERFGRSLLELGGNNAIIVFEDADLNLVIPSALFAAVGTAGQR
CTTARRLFLHESIHDEVVAKLAKAYAQVRIGDPWDSDTLYGPLHTKEAVKMFLDAVEQAK
QQGGSVVCGGKVINRPGNYVEPTIVTGLPHNAPIVHTETFAPILYVLKFKEEEEVFAWNN
EVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESG
SDSWKLYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttgagactttcattggcgagtttgttcattggcgagttcgttcattcaaacaa
gccaatcaacaagcgccacttgagcactacatcacaagacaggacatcggatccccatgt
cacttccgcttccgggtcacacctcctacatcaccagatggtaatttggaggattatgaa
gaaacagtaaagaaggctaaagaggcatggaaggtctgggctgatatccctgcacctaaa
cgtggagaaatagtgcgacagattggtgatgccctgagacaaaaaatcaaagttctagga
agcttggtctctttagaaatgggaaagatttttgtcgagggtgttggggaagtgcaggag
tatgttgatgtctgtgactatgctgttggtttgtccagaatgattggtggacctattttg
ccttcagaaagacctggccatgcccttatagagcagtggaatcctgttgggctggtggga
gtcatcacagccttcaacttccccgtggcagtttatgggtggaacagcgcaattgcaatg
atctgtggaaacgcttgcctgtggaagggtgctcctacaacatcccttgttagtgttgct
gttacaaagataattgcaaaagtcttggaggataacaagttgcctggagcaatctgctct
ctggtttgtggtggagcagacattgggacagcaatggctagagatgagagaatggacctc
ttatccttcactggcagcacaaaagtgggcaaacaagtagcgcttatggttcaggagaga
tttggtcgaagcctgctggaactgggaggaaacaatgccattattgtgtttgaagatgca
gacctgaacctagtcattccatctgctctatttgctgctgtgggaacagcaggtcagaga
tgcacaactgctagaaggctgtttctccatgaaagcatccatgatgaggtggtggcaaag
cttgccaaggcctatgcccaggtccgcatcggtgatccatgggattctgacactctgtat
gggcctcttcataccaaagaagcagtgaaaatgttccttgatgcagtagaacaagcgaaa
cagcaaggtggctctgtggtttgtggcggaaaggttataaatcgccctgggaactatgtt
gaaccaaccattgtgactggccttcctcataatgcgcccattgtccacactgagacgttt
gcccccatattgtatgtgctgaaatttaaggaggaagaggaggtttttgcctggaataat
gaagtaaaacaaggtctttccagcagtatctttaccaaggatttgggaaggattttccgc
tggctagggccaaagggatctgactgtggcattgtgaatgttaacatcccaaccagtgga
gctgagattggaggtgcttttggtggtgaaaagcacactggtgggggaagagaatctgga
agtgattcatggaaactttatatgagacggtctacttgtacaatcaactacagcaaagat
ttgcccttggctcaaggaatcaagtttcagtaa

DBGET integrated database retrieval system