KEGG   Geospiza fortis (medium ground-finch): 102042858
Entry
102042858         CDS       T03755                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04068  FoxO signaling pathway
gfr04110  Cell cycle
gfr04115  p53 signaling pathway
gfr04218  Cellular senescence
gfr04310  Wnt signaling pathway
gfr04340  Hedgehog signaling pathway
gfr04371  Apelin signaling pathway
gfr04510  Focal adhesion
gfr04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102042858 (CCND1)
   04340 Hedgehog signaling pathway
    102042858 (CCND1)
   04371 Apelin signaling pathway
    102042858 (CCND1)
   04068 FoxO signaling pathway
    102042858 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102042858 (CCND1)
   04115 p53 signaling pathway
    102042858 (CCND1)
   04218 Cellular senescence
    102042858 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102042858 (CCND1)
   04530 Tight junction
    102042858 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102042858
NCBI-ProteinID: XP_005426170
UniProt: A0A6I9HMV3
LinkDB
Position
Un
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDIKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccgacgagcctacctggatgcc
aacctcctcaatgacagggtgctgcagacaatgctcaaggcggaggagacctgctcgccc
tccgtctcctacttcaagtgcgtgcagaaagaaatcttgccatatatgaggaaaatagtt
gccacttggatgctggaggtttgcgaggagcagaagtgcgaagaggaagttttccccttg
gctatgaattatttggacagatttttgtcgttcgaacccctcaagaaaagccgattgcaa
ttgctcggagctacctgcatgtttgtggcttcaaaaatgaaggaaactattcctctgacc
gcagaaaaactgtgcatttatacagataactccattagacccgacgaattactgcaaatg
gagctgctgctggtgaataagctgaaatggaatctggccgcaatgaccccccacgatttc
attgaacatttcctcactaaaatgcctctggcagaggacaccaagcagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatattaaatttatttcaaacccaccc
tccatgatcgcagctggcagcgtggtagcagctgtgcaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgagtccctcctggagtccagtctacgc
caggcacagcagcacaacgtatcctcagaaacaaagactgtagaggacgaagcagacctc
tcctgcacacctactgatgtgcgagacgtgaacatttaa

DBGET integrated database retrieval system