KEGG   Geospiza fortis (medium ground-finch): 102043209Help
Entry
102043209         CDS       T03755                                 

Definition
(RefSeq) actin, cytoplasmic type 5
  KO
K05692  actin beta/gamma 1
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04145  Phagosome
gfr04210  Apoptosis
gfr04510  Focal adhesion
gfr04520  Adherens junction
gfr04530  Tight junction
gfr04810  Regulation of actin cytoskeleton
gfr05132  Salmonella infection
gfr05164  Influenza A
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102043209
  09143 Cell growth and death
   04210 Apoptosis
    102043209
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102043209
   04520 Adherens junction
    102043209
   04530 Tight junction
    102043209
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102043209
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102043209
  09172 Infectious disease: viral
   05164 Influenza A
    102043209
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gfr03021]
    102043209
   03019 Messenger RNA biogenesis [BR:gfr03019]
    102043209
   03036 Chromosome and associated proteins [BR:gfr03036]
    102043209
   03029 Mitochondrial biogenesis [BR:gfr03029]
    102043209
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gfr04812]
    102043209
   04147 Exosome [BR:gfr04147]
    102043209
Transcription machinery [BR:gfr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     102043209
Messenger RNA biogenesis [BR:gfr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     102043209
Chromosome and associated proteins [BR:gfr03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     102043209
    NuA4 complex
     102043209
  Chromatin remodeling factors
   BAF complex
    102043209
   PBAF complex
    102043209
   SWR1 complex
    102043209
Mitochondrial biogenesis [BR:gfr03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    102043209
Cytoskeleton proteins [BR:gfr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     102043209
Exosome [BR:gfr04147]
 Exosomal proteins
  Proteins found in most exosomes
   102043209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 102043209
NCBI-ProteinID: XP_005430102
LinkDB All DBs
Position
Un
AA seq 376 aa AA seqDB search
MADEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLD
LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKS
YELPDGQVITIGNERFRCPESIFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVL
SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
QEYDESGPSIVHRKCF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaggagatcgctgccctggtggtggacaacggctcggggatgtgcaaggcg
ggcttcgcgggggacgacgcgccccgcgccgtcttcccctccatcgtggggcggccgcgg
caccagggcgtcatggtgggcatgggccagaaggacagctacgtgggcgacgaggcgcag
agcaagaggggcatcctcaccctcaagtaccccatcgagcacggcatcgtcaccaactgg
gacgacatggagaagatctggcaccacaccttctacaacgagctgcgcgtggcgcccgag
gagcacccggtgctgctcaccgaggcgccgctcaaccctaaagccaacagggagaagatg
acgcagatcatgttcgagaccttcaacacgccggccatgtacgtggccatccaggccgtg
ctgtccctctacgcctcgggccgcaccacgggcatcgtgatggactccggcgacggcgtc
acgcacacggtgcccatctacgagggctacgccctgccccacgccatcctgcgcctggac
ctggccggccgcgacctcaccgactacctcatgaagatcctcaccgagaggggctacagc
ttcaccaccacggccgagcgcgagatcgtgcgcgacatcaaggagaagctgtgctacgtg
gcgctggacttcgagcaggagatggccacggccgcctcctcctcctcactggagaagagc
tacgagctgcctgatgggcaggtcatcaccatcggcaacgagcgcttccgctgccccgag
tccatcttccagccctccttcctgggcatggagtcctgcggcatccacgagaccaccttc
aactccatcatgaagtgtgacgtggacatcaggaaggatctgtacgccaacaccgtgctg
tccgggggcaccaccatgtacccaggcatcgccgaccgcatgcagaaggagatcacggcg
ctggctcccagcaccatgaagatcaagatcatcgccccccctgagcgcaagtactccgtg
tggatcggcggctccatcctggcctcgctctccaccttccagcagatgtggatcagcaag
caggagtacgacgagtccggcccctccatcgtgcatcggaaatgcttctag

DBGET integrated database retrieval system