KEGG   Geospiza fortis (medium ground-finch): 102043446
Entry
102043446         CDS       T03755                                 

Gene name
STEAP3
Definition
(RefSeq) STEAP3 metalloreductase
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
gfr04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    102043446 (STEAP3)
   04115 p53 signaling pathway
    102043446 (STEAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gfr04131]
    102043446 (STEAP3)
Enzymes [BR:gfr01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     102043446 (STEAP3)
Membrane trafficking [BR:gfr04131]
 Exocytosis
  Others
   Others
    102043446 (STEAP3)
SSDB
Motif
Pfam: F420_oxidored Ferric_reduct NAD_binding_2 IlvN
Other DBs
NCBI-GeneID: 102043446
NCBI-ProteinID: XP_014161823
UniProt: A0A6I9Z8T6
LinkDB
Position
Un
AA seq 468 aa
MTGPNQDVQRRPGHASDFARSLAVRLVRSGFRVVVGSRNPKRKASLFPAAAEVTFQAEAA
KKADVIFVAIFREHYSTLCDLADVLVGKILVDVSNNTEINHHKESNAEYLASLFPACTVV
KAFNVVSAWTLQSGARDGNKQVLICSNNQEAKRTIAEIAQVMGFTPVDMGCMSSACEIEN
IPLRLLPAWKIPTFLALGLFLCFFTYNLIRQVIHPYIREQKNKLYKIPIEVVNTTLPCVS
YVMLSLVYLPGVLAACSQLYYGTKYRRFPDWLDQWLQHRKQIGLLSFFCAALQAVHSLCL
PMRRSHRYLLIETAVKQAMEKKKTIWVEEEVWRMEIYISVGIIALGLLSLLAITSLPSIA
NSLNWREFSFIQSSLGFIALVISTLHTLTYGWSRAFDENQYKFYLPPTYTLTLLVPCTVI
IARVIFSLPCIQHRLLRIRRGWEKGRYVKFVLPSATGEFSSGETSSNV
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgacgggtccaaatcaagatgtccagaggagacctggccatgcctcggacttcgcgcgc
tccttggccgtgcgcctggtgcgctccggcttcagggtggtggtgggcagccgcaacccc
aagcgcaaagccagcctgttccctgctgcagcagaggtcaccttccaggccgaggctgcg
aagaaggccgatgtcatcttcgtggccattttcagggagcattattccaccctctgtgac
ctggctgatgtgctggtgggcaagatcctggtggatgtcagcaacaacacggagatcaac
catcacaaggaatccaacgcggagtacttggcctccctgttcccagcctgcaccgtggta
aaggcctttaatgtggtttctgcgtggacgctgcagtcgggtgccagggatggaaataag
caggtcctgatctgctcaaataaccaagaagccaagcgcaccatagcagaaattgctcaa
gtcatgggattcacccccgtggacatgggctgcatgtcatcagcctgtgagatcgagaac
attcccctgcgcctcctgccagcctggaaaatccccacctttttggctctggggcttttt
ctttgcttcttcacctacaacctgatccggcaggtcatccacccttacatcagggagcag
aagaacaagctgtacaagatccccatcgaggtggtcaacaccacgctgccgtgcgtctcc
tacgtcatgctgtctctggtctacctgcccggggtgctggcagcctgctcccagctctac
tacggcacgaagtacaggcgtttcccagattggctggaccagtggctgcagcacaggaag
cagattggtctcctcagcttcttctgtgcagccctgcaggctgtgcacagcctgtgcctg
cccatgcgccgctcccaccgctacctgttaatcgagacggccgtcaagcaggctatggag
aagaagaagacaatctgggtagaggaggaagtctggaggatggagatttatatctctgtt
ggaataattgccctgggcttgctgtcgttacttgccatcacttcacttccatccatcgca
aactctctcaactggagggaattcagtttcattcagtcctcccttggatttattgccttg
gtgatcagcactctgcacacgctcacgtacggctggtcgagggccttcgatgagaatcag
tacaaattctacctgcccccaacctacaccctcaccctgctggtcccatgcactgtgatc
atagccagagtcatcttcagtttgccctgcatccagcacagacttctgagaatcaggagg
ggctgggagaagggcagatatgtcaaatttgttctgcccagcgcaacgggggaattctca
agtggggagacctccagtaatgtctaa

DBGET integrated database retrieval system