KEGG   Geospiza fortis (medium ground-finch): 102043600Help
Entry
102043600         CDS       T03755                                 

Gene name
NEU2
Definition
(RefSeq) neuraminidase 2
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00511  Other glycan degradation
gfr00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    102043600 (NEU2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102043600 (NEU2)
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     102043600 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR BNR_3 Sec_GG
Motif
Other DBs
NCBI-GeneID: 102043600
NCBI-ProteinID: XP_005430280
LinkDB All DBs
Position
Un
AA seq 377 aa AA seqDB search
MLSYIEPAAVPQCSNPCSTMAAFPVLQQETLFRNFAEEREDLVDEHAKLIVMRRGVYDPT
MQHIQWKRMETLVSAKLEGHRSMNPCPVYDEVSGKLILFFIAVPGKISEQHQLRTKINLV
RLCYVTSMDQGRTWSAAQDVTDRTIRNEYKNWATFAVGPGHGLQLLDEARSLVIPAYAYR
ILDPKQHPTPHAFCFISSDHGTTWEQGNFVGGESAVECQVAEVHTCGRKVLYCNARSDRG
ARIQAVSYNHGLDFEGGQRVEMLVEPPSGCHGSVTAFPPPPDARCQDSWLLYAHPTDPRG
RKDLGIYLNKSPLNPAHWTKPSILFKGLCAYSDLQYMGVGPDGSPLFSCLFEYGTHRQCE
EMIFVMFTLKQAFPSEH
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgctgagctatatagaaccagcagctgtgccacagtgcagcaacccatgcagcacaatg
gctgcgttccctgtcctgcagcaagaaacgttattccggaactttgctgaggagcgagag
gacctggtggatgaacatgccaagctgatagtcatgcgcagaggcgtgtacgacccaacc
atgcagcacattcagtggaaaaggatggagacccttgtcagtgcaaagcttgaaggccat
cgatctatgaacccctgcccggtatatgatgaagtctcaggaaaactcatcttgttcttc
atagctgtcccaggaaagatctctgagcagcatcagctgaggacaaagatcaacctggta
cgtctctgctatgtcactagcatggaccaaggacgcacctggagcgctgcccaagatgtc
accgacaggaccattaggaatgagtacaagaactgggccacctttgcggtggggccaggt
catggattacaattgctcgatgaggcccggagccttgtgattcctgcctatgcctatcgt
atcttggaccccaagcagcaccccactcctcatgccttctgcttcatcagctctgaccat
gggacaacatgggagcaggggaactttgtggggggggagagtgcagtggagtgccaggta
gcagaggtgcatacctgtggcagaaaggtcctttactgcaatgcaaggagtgacagggga
gccaggatccaggccgtcagctacaaccatgggctggacttcgagggaggccagcgggtt
gaaatgctagtagaacctccctcgggatgccatggaagtgttactgccttcccacctccc
ccagatgccagatgtcaagatagttggttactctacgctcatcctacagacccaaggggt
cgaaaagatttaggaatttacctcaacaaaagccctttaaatccagcacactggacaaaa
cccagcatactcttcaagggcctgtgtgcttattcagatctgcagtacatgggcgttggg
cctgacggctcacctttgttctcctgcctctttgaatatggaacccacagacaatgtgaa
gagatgatttttgtcatgttcactttgaagcaagcctttccctcagaacactga

DBGET integrated database retrieval system