KEGG   Geospiza fortis (medium ground-finch): 102043659
Entry
102043659         CDS       T03755                                 

Gene name
PMAIP1
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
gfr04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102043659 (PMAIP1)
   04115 p53 signaling pathway
    102043659 (PMAIP1)
SSDB
Motif
Pfam: PMAIP1
Other DBs
NCBI-GeneID: 102043659
NCBI-ProteinID: XP_005428423
UniProt: A0A6I9HR05
LinkDB
Position
Un
AA seq 76 aa
MKALSRRVSAGREAAAECALELTRIGDRWDLRQRLLNLLAKLFRPGTWAARGHGERSGRG
PWLCGFGRRGSTDIGR
NT seq 231 nt   +upstreamnt  +downstreamnt
atgaaagcgctaagcaggcgcgtttccgcagggcgagaggcggcggcggagtgcgccctg
gagctgacccgcatcggcgacaggtgggacctgcggcagaggctcctgaacctgctcgcc
aagctcttccgccccggaacgtgggctgcccgcggacacggcgaacggagcggaagagga
ccttggctttgtgggttcggaagaagaggctccacagacattgggagatga

DBGET integrated database retrieval system