KEGG   Geospiza fortis (medium ground-finch): 102043850Help
Entry
102043850         CDS       T03755                                 

Gene name
HDAC10
Definition
(RefSeq) histone deacetylase 10
  KO
K18671  histone deacetylase 10 [EC:3.5.1.98]
Organism
gfr  Geospiza fortis (medium ground-finch)
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gfr03036]
    102043850 (HDAC10)
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102043850 (HDAC10)
Chromosome and associated proteins [BR:gfr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102043850 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl STAR_dimer
Motif
Other DBs
NCBI-GeneID: 102043850
NCBI-ProteinID: XP_014162450
LinkDB All DBs
Position
Un
AA seq 750 aa AA seqDB search
MSEHATQPGARGCFALGPVPHSNPSSGCTPRLRPCGRGAPQRPANRASNRAPVYCEICVL
VFLFCSVVAMASGTALIYDEEMTAHKLLWNDPICDIEVPERLSFSYEQLRSYHLVERCVH
VPAREGSEEEILLVHSLEHLEMAKSTQTMNEEELKRVSENYDAFFFHPSTYHCARLAVGA
ALQLVDAVMAGKVRNGMALVRPPGHHSQRNAANGFCLFNNVAIAAEYAKLKYGLQRILIV
DWDVHHGQGTQYIFEEDPSVLYFSWHRYEHQEFWPSLKESDYDAVGLGKGKGFNINLPWN
KVGMGNSDYLAAFFHVLLPMAFEFDPELVIVSSGYDSGIGDPEGQMNATPEVFAHLTHFL
MQLANGKLCVILEGGYHLKSLGESVCMTVKTLLGDPVPQITGEMAPCLSAVESIQNVRAA
HKPYWKCLAYEDTSFLQNLSTKSHLLKKANSNPSAEDESQITNNNNTVKVERFLELHMKN
ILFPVPPIKTATTGSEGSEYFLPEHVQLVKEMDETEIKVLVSGFYADLVKEEKTLLSLGS
TFVILDKILKKEVCNGIAASPTAALSAAVAVRHCVRFGFQRVLCVFVGDMQMIPNTEDGK
MLVINICEKEQSRKTSCKHYISLNWKEDAGGNDFFSAVLGFILPVAYSYQPNLTVVAVGP
NRNLGISGISLLVALLRGLAESRVFVVIEDTEISLMQTVAEALVGTSTPPFGIYVPPTQE
KVNKIKALRDQFQQEWKMLQCSVKDGISRN
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcacgccacacagcccggggctaggggttgtttcgctcttgggccagttcca
cactcaaacccctccagcggttgcactccccggttacggccctgcggccgcggagccccg
cagcgcccggcgaaccgcgcctcgaaccgcgctcccgtttactgtgaaatatgtgtcttg
gtgtttttgttctgttcagttgtagcaatggcttcaggaacagcgctgatttatgatgag
gagatgaccgctcacaaactgctttggaatgatcccatttgtgatattgaagtgccagaa
agactttcattctcctatgagcagcttagaagttaccatcttgtggaaaggtgtgtccat
gtgcctgccagagaaggaagcgaggaggagatcctattggtccacagtttagagcacttg
gaaatggcaaaaagcactcagacaatgaatgaagaggagctgaaaagggtctctgaaaat
tatgatgcttttttctttcatccgagcacttaccactgtgccaggctagcagtaggagca
gctttgcagctggtggacgctgtgatggcagggaaagtgcgcaatggaatggccttagtc
agacctccaggtcaccacagccagagaaacgcagctaatggcttctgtttgttcaacaat
gtggctattgcagcagaatatgcaaaactgaaatatggtctgcagagaatcctaattgtt
gactgggatgtgcaccatgggcaaggaactcaatatatatttgaagaagatccaagtgtt
ttgtacttttcttggcatcgctatgagcatcaggaattctggccatcactcaaagaatcc
gattatgatgctgttggtctgggaaaaggaaaaggttttaacataaatttgccttggaat
aaggttgggatgggaaattcagattatcttgctgcatttttccatgtgttgcttccaatg
gcttttgagtttgatcctgaactggttattgtctcctctggatatgattctggaattggt
gaccctgaaggtcagatgaatgccactcctgaggtttttgcccaccttacccatttcctg
atgcagttagctaatggaaagctgtgtgtcatcctagagggtggataccacttgaaatca
ttgggtgaatcagtgtgcatgactgtaaaaactttgcttggagatcctgtacctcaaata
actggagaaatggcaccttgtctaagtgctgttgaatctattcaaaatgtgagagcagca
cataaaccctactggaaatgtttggcttatgaagatacatcatttttacaaaatttgagc
accaaatcacacttactaaagaaggctaattcaaatccctccgcagaagatgaatctcag
ataactaacaacaacaacactgtcaaagtagaaagatttttggaattgcacatgaaaaat
attctatttccagtgcctcccatcaaaacagcaacaactggctctgaaggttcagaatat
tttcttcctgaacatgttcagctggtgaaggaaatggatgaaacagaaataaaagttctt
gtcagtggtttttatgcagaccttgtgaaagaggagaaaactttgctctctcttggcagt
acatttgtgatcctagataaaattcttaagaaggaggtatgtaatggaattgcagcatca
cccacagccgctctttctgctgctgttgcagtaagacattgtgttcgttttggatttcaa
agagtgctttgtgtatttgttggagacatgcagatgatacccaacacagaagatggaaaa
atgcttgtcataaacatctgtgagaaagaacagtccagaaagaccagctgcaaacactat
atttctctaaactggaaagaggatgctggaggaaatgatttcttttctgctgtacttgga
ttcattcttcctgtagcatatagttatcaaccaaacttaacagtagtagctgttggacca
aacaggaaccttggaataagtgggatttctctgcttgttgctttactacgaggattggct
gagtctcgagtttttgttgtgattgaggacacagagataagtttaatgcaaactgtagcc
gaagcattagtgggcacttctacacctccctttggaatttatgtacctcctacccaagag
aaagtaaataaaataaaagcattaagagaccagtttcagcaagaatggaaaatgcttcag
tgttcagtgaaggatggaatttccagaaattga

DBGET integrated database retrieval system