KEGG   Geospiza fortis (medium ground-finch): 102043868
Entry
102043868         CDS       T03755                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04010  MAPK signaling pathway
gfr04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102043868 (CACNA1E)
   04020 Calcium signaling pathway
    102043868 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gfr04040]
    102043868 (CACNA1E)
Ion channels [BR:gfr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102043868 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 102043868
NCBI-ProteinID: XP_014165656
LinkDB
Position
Un
AA seq 2241 aa
MLGFGTCSMGAPARVADLDAASSRCILALPEEETWRQHRLGLMQNTHSCNLLEPQSLAQA
LVSRAASLDALCESRCHDGEAEPGLAQLVAVSPEVIKRRRGGLIEQRDIIKAHEAHKMQS
TPQARRKEWERGTFGEAGWGRMGSSTSGSNRSRQGAAAPAGGSPGAFKQTKAQRARTMAL
YNPIPVRQNCFTVNRSLFLFGEENIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHL
PEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFVFHKGSYLRNGWNVMDFIVVLSGI
LATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAI
LMFAIIGLEFYSGKLHRACYTNNSGELEELDPPHPCGVQGCPPGYECREWIGPNDGITQF
DNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSG
EFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEVLRR
ATIKRNRTDAMSGDEHCVDISSVGNPSSHSGLKGARVDGASYLRHKERLLRISVRHMVKS
QVFYWIVLSLVALNTACVAIVHHNQPAWLTHFLYYAEFLFLGLFLLEMSLKMYGMGPRLY
FHSSFNCFDCGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVS
LMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFMDGTPSANFDTFPAAIMTVFQILT
GEDWNEVMYNGIRSQGGVRSGMWSSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKD
EQEEEEAFNQKHALQKAKEVSPMSAPNMPAIERDRRRRHHMSMWEPRSSHLRERRRRHHM
SVWEQRTSQLRRHMQMSSQEGINKDEPPLINPHASIFRRKRPGEGVTLEKCAEEQGKAER
EGAEQPVPGANPGGGEERTSPRAKRDMWQQKSCHGNCEPGEQDGAGGSMEDRARMRQSQR
RSRHRRARVEGKDTAGILGSRSASQEMGLEEASTAEGTQDGDRRGDVAAAEALIPGEPEA
SGESIRTNGIPAGDADLIGTARRGSPPHVAAELCQGRTGTLPEQECSSPDTSEQALLEPS
RSVSRSEPDLSSITPNTEKATESTAIMIDVHDSAVVQISNKTDGEASPLKEAETKEDEEE
MEKKKRKKEKSETGKAMVPHSSMFIFSTTNPVRRACHYIVNLRYFEMCILLVIAASSIAL
AAEDPVLTNSDRNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFIVV
VGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVF
NILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTQKDCIGNYVDHEKNKMEVKCREWKR
HEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVF
PFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYR
VWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPYTYELALKYLNIAFTMVFSLECVLKII
AFGFLNYFRDTWNIFDFITVIGSITEIILTDTKLVNTSSFNMSFLKLFRAARLIKLLRQG
YTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFL
GSLMLLFRSATGEAWQEIMLSCLEGKGCEPDTTATSGQNENERCGTDLAYVYFVSFIFFC
SFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWAEYDRAACGRIHYTEMYEMLTL
MSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADWQQ
LDSELQKEILTIWPHLSQKMLDLLVPMPKTSDLTVGKIYAAMMIMDYYKQSKAKKQRQQL
EEQKNAPMFQRMEPSSLPQEIISNAKALPYLQQDTLSGLSSRGGFSSLSPLSPQEIFQLA
CMDPAQEQFQEHQSLEPEVREFQRVQPSNRGSYLPVDTQDHAVSGRASSMPRLTVDPQVV
TDTSSMRRSFSTIRDKRPNSSWLDEFSMERSSDNTYKSRRRSYHSSLQLSARRLNADSGH
RSEGHRTGRERGRSKERKHLLSPDISRCNSEERSPQAQEESPERRRESRSPSEGRSQTPS
RQGMGSLRKEEIHVGRGVKMS
NT seq 6726 nt   +upstreamnt  +downstreamnt
atgctgggattcgggacgtgctccatgggcgccccggcgagggtggctgatctggacgcc
gcctcgtcccgctgcatcctggccctgcccgaggaggagacgtggcgccagcaccgcctg
gggctgatgcagaacactcattcctgcaacctgctggagccccagagcctggcccaggcc
ctggtgtcccgcgccgcctccttggacgcgctgtgcgagtcgcgctgccacgatggcgag
gcagagccggggctggcccagctggtggccgtgagccccgaggtgatcaagcgccggcgg
ggagggctcatcgagcagagggacatcatcaaggcccacgaggcacacaagatgcagagc
acgccccaggcacggaggaaggaatgggagagagggacttttggtgaagcaggatggggg
agaatgggttccagcacatctgggtctaaccggagccggcaaggagctgctgcccctgcg
ggaggcagcccgggagccttcaagcaaaccaaagcgcagagagcccggactatggctctg
tacaaccccatccccgtccggcagaactgcttcaccgtcaacagatcgctcttcctcttc
ggggaagagaacatagtcaggaaatacgccaagaagctcatcgactggcctcccttcgag
tacatgatcctggccaccatcattgccaactgcatcgtgctggccctggagcagcacctc
cccgaggatgacaagacgcccatgtcgcggagattagagaagacagagccctacttcatt
gggattttctgcttcgaggctgggattaagatcgtggccctggggttcgtgttccacaag
ggctcgtacctgcgcaacggctggaacgtcatggacttcatcgtggtcctcagtggcatc
ctcgccacggccgggacacacttcaacacccacgtggacctgcggacgctgcgggccgtg
cgcgtgctccggccgctgaagctcgtctcgggcattcccagcttgcagattgtcctgaaa
tccatcatgaaggccatggtgcctctcctgcagatcggcctgctgctcttttttgccatc
ctcatgtttgccatcatcggcctggagttctacagcgggaagctgcaccgagcctgctac
acaaacaattcaggtgaactagaggagctggaccctccccatccctgcggggtgcagggt
tgtcccccgggctacgagtgccgggagtggatcggtcccaacgacgggatcacgcagttc
gacaacatcctctttgctgtgctgaccgtcttccagtgcatcaccatggaagggtggacc
acagtcctgtacaacaccaatgatgccttaggagccacctggaactggctgtacttcatc
cccctcatcatcattggatccttcttcgtcctcaaccttgtcctgggagtgctgtcaggg
gagtttgccaaagagagagagcgcgtggagaaccgccgagccttcatgaagctgcggcgg
cagcagcagatcgagcgggagctcaacggctaccgggcgtggatagacaaagcggaggaa
gtcatgctggctgaagagaacaaaaattcggggacctcagccttagaagtgctcaggaga
gccaccatcaagcggaaccgcacggatgccatgtcgggtgacgagcactgtgtcgacatc
tcctccgtgggcaacccctcaagtcactctggcctcaaaggtgccagggtggatggtgcc
tcctacttacggcacaaggagcggctgctgcgcatctccgtgcgccacatggtcaaatcc
caggtcttctactggatcgtcctgagcctggtggctctcaacactgcctgcgtggccatc
gtccatcacaaccagccagcctggctcacccacttcctctactatgcagagttcctgttt
cttgggctcttccttctggagatgtccttaaagatgtacgggatggggccacgcctctac
ttccattcttccttcaactgcttcgactgtggggtcacagtgggaagcatcttcgaagtg
gtttgggctatattcagaccaggaacctcttttgggatcagtgtcctacgagctcttcgt
ctcctgaggatatttaaaataaccaagtactgggcatccctgaggaatttagtggtctcg
ctgatgagctccatgaaatctattatcagtctgctcttcctcctcttcctcttcattgta
gtctttgccctgctgggaatgcagctgtttggaggcaggtttaacttcatggatgggact
ccctcggccaactttgacaccttccctgcagccatcatgacggtgtttcagatcctgacg
ggcgaggactggaacgaggtgatgtacaacggcatccgctcccagggaggcgtgcgctca
gggatgtggtcctccatctacttcatcgtcctcaccttgtttgggaactatactctgctg
aacgtcttcttggccatcgccgtggacaacctggccaatgcccaggagctcaccaaggac
gagcaggaggaagaggaggcctttaaccagaagcacgccctgcagaaagccaaagaagtc
agccccatgtctgccccaaacatgcctgctatcgaaagagacaggcggaggagacaccac
atgtcgatgtgggagccacgcagcagccacctgcgggagcggcggcggaggcaccacatg
tcggtgtgggagcagcgcaccagccagctgcgccggcacatgcagatgtccagccaggag
ggcatcaacaaggacgagccgcccctcatcaacccccacgccagcatcttccgcaggaag
agacccggggaaggtgtcaccctggagaaatgcgccgaggagcagggcaaggcagagcgc
gagggagccgagcagccggtgccaggggccaaccccggcggtggggaggagaggacatcg
ccccgggccaagcgggacatgtggcagcagaagtcctgccacgggaactgtgagccagga
gaacaggacggggcgggaggcagcatggaggatagggcgaggatgaggcagagccagcgg
cgcagccggcaccgcagagcccgcgtggagggcaaagacacagctggcatcttggggagc
cgctcggccagccaggagatggggctggaggaggccagcactgccgaggggacacaggat
ggggaccggcgcggggacgtggctgcagcagaggcgctgattccgggggagccggaggcg
agcggggagtccatcaggacaaacgggatccctgctggtgacgccgatctgatcggcacc
gccaggaggggcagccccccacacgtggcagccgagctgtgccaggggaggacgggcacg
ctgccggagcaggagtgcagcagcccggacacgagcgagcaggcgctgctggagcccagc
cgcagcgtgagccgcagcgagcccgacctgtcctccatcacccccaacaccgagaaggcc
accgagagcacggccatcatgatcgatgtgcacgactccgctgtggtacagattagcaac
aagacagacggtgaagccagccccttaaaggaggctgagaccaaagaagatgaggaagaa
atggagaagaagaagaggaagaaggaaaagagcgagacgggcaaagccatggtgccgcac
agctccatgttcatcttcagcaccaccaacccggtgaggagggcctgccactacatcgtg
aacctgcgctacttcgagatgtgcatcctgctggtgatcgctgccagcagcatcgccctc
gccgccgaggatcccgtcctcaccaactccgaccgtaacaaagtgctgaggtatttcgac
tacgtcttcactggtgtcttcaccttcgagatggtgatcaagatgattgatcagggcttg
atcctgcaggatggctcctacttccgagacctctggaacatcctggatttcattgtggtg
gtgggagcactggtggcttttgccttggcgaatgctttggggaccaacaagggccgggat
atcaagaccatcaagtctctccgtgtgctgcgggtcttgaggcccctgaaaaccatcaag
aggctgcccaagctgaaggctgtttttgactgtgtagtgacatctctcaagaacgtcttc
aacatcctcattgtctacaagctcttcatgttcatcttcgccgtcatcgccgtgcagctc
ttcaaggggaagttcttctactgcactgacagctccaaggacacgcagaaggactgcata
gggaactacgtggaccacgagaagaacaagatggaggtgaaatgcagagagtggaagcgg
cacgagtttcactatgacaacatcatctgggctctgctcaccctgttcacggtgtccacg
ggcgaggggtggccccaggtgctgcagcactcggtggatgtgacggaggaggaccgcggg
cccagccgcagcaaccgcatggagatgtccattttttatgtcgtctacttcgtggtcttc
cccttcttcttcgtcaacattttcgtggctctcatcatcatcaccttccaagagcaagga
gacaaaatgatggaggagtgcagcctggagaagaacgagagggcctgcattgactttgcc
atcagcgccaagcccctgacgaggtacatgccccagaacagacacaccttccagtaccgc
gtgtggcacttcgtggtgtccccgtccttcgagtacaccatcatggccatgatagccctc
aacaccgtggtgctcatgatgaagtactattctgctccatacacctatgagctggccctg
aagtacctgaacatcgccttcaccatggtgttctccctggagtgcgtcctcaagatcatt
gcctttggcttcctgaattatttccgggacacctggaacatctttgacttcatcacggtc
atcggcagcattacggagatcatcctgacggacaccaagctggtgaacaccagcagcttc
aacatgagcttcctgaagcttttccgggctgctcggctcatcaagctgctccgccagggt
tacaccatccgcatcctgctctggacctttgtgcagtccttcaaggcactcccctacgtc
tgcctgctgattgccatgcttttcttcatctacgccatcattgggatgcaggtttttggc
aacatcaaactcgatgaggaaagccacattaacaggcacaacaatttccgcagcttcctg
ggctccctcatgctcctcttcaggagtgccactggagaggcgtggcaggagatcatgctg
tcctgcctggagggcaagggctgcgagccggacaccacggccacgtccgggcagaacgag
aacgagcgctgcggcaccgacctggcctacgtttacttcgtgtccttcatcttcttctgc
tccttcctgatgctcaacctgtttgtggcagtcatcatggacaactttgagtacctgaca
cgggactcctccatcctgggccctcaccatctggatgagtttgtcaggatctgggcagag
tatgaccgagcagcgtgtggccgaatccattacactgagatgtatgaaatgctgactctt
atgtcaccaccgctaggcctcggcaagagatgtccttccaaagtggcctataagagactg
gtgctgatgaacatgcccgtggccgaggacatgacagtccatttcacctccaccctcatg
gccctcatccgcacagccttggacatcaaaattgccaaaggtggtgcagattggcagcag
ttggactccgagcttcaaaaggagatcctgaccatttggcctcacctctcccagaagatg
ctggacctgttggtgcccatgccaaaaacctctgacctgactgttgggaaaatatatgca
gccatgatgatcatggattactacaagcagagcaaggcgaagaagcagcggcagcagctg
gaggagcagaagaatgcccccatgttccagcgcatggagccgtcctctctgccgcaggag
atcatctccaatgccaaggctctgccatacctccagcaggacaccctctcgggcctgagc
agccgaggcgggttctcctcgctgagcccgctctcgccacaggagatcttccagctggcg
tgcatggatccagcccaggagcagttccaggagcaccagtctctggagccagaggttagg
gagtttcaaagagtgcagccctctaaccgtggcagctaccttcccgtggacactcaggac
cacgctgtctctgggagggcctcctccatgcctcgtctcactgtggatccccaggtggtg
acagacaccagctccatgcggagatccttctccaccatccgggacaagcggcccaacagc
tcctggctggatgagttctccatggagcgcagcagtgacaacacctacaagtcccgccgg
cgcagctaccactcctcgctccagctgtccgcccggcgcctcaacgccgactcgggccac
cggtccgaggggcaccgcacgggcagggagcggggccggtccaaagagcgcaagcacctg
ctgtccccggacatctcccgctgcaactccgaggagaggagtccccaggcacaggaggag
tcgccggaacggcggcgcgagtcacggtcacccagcgagggcaggtcgcagacacccagc
aggcagggcatgggctccctgagaaaagaagaaatccatgtgggcaggggagtgaagatg
tcgtga

DBGET integrated database retrieval system