KEGG   Geospiza fortis (medium ground-finch): 102044323
Entry
102044323         CDS       T03755                                 

Gene name
RFWD2
Definition
(RefSeq) ring finger and WD repeat domain 2
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
gfr04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102044323 (RFWD2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102044323 (RFWD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gfr04121]
    102044323 (RFWD2)
Enzymes [BR:gfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102044323 (RFWD2)
Ubiquitin system [BR:gfr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    102044323 (RFWD2)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     102044323 (RFWD2)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-RING_5 zf-RING_2 zf-RING_UBOX zf-C3HC4_3 zf-rbx1 WD40_like zf-C3HC4_4 zf-RING_4 Prok-RING_4 zf_C2H2_10
Other DBs
NCBI-GeneID: 102044323
NCBI-ProteinID: XP_005429687
UniProt: A0A6I9HUL4
LinkDB
Position
Un
AA seq 590 aa
MIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRSE
EKRLKLDHSVSSTNGHRWQIIQDLLGTDQDNLDLANVNLMLELLVQKKKQLEAESHAAQL
QILMEFLKVARRNKREQLEQIQKELSVLEEDIKRVEEMSGLYSPVSEDSTVPQFEAPSPS
HSSIIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRLTAHFEDLEQCYFSTRMTRVSD
DSRTTSQLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGV
TKKIKVYEYGTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGF
TGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCV
KFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQ
LKLWNVGKPHCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFD
TVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgattgaggaagcctacatgacgaaatgtggacacagcttctgctataaatgtattcac
cagagcctggaggacaataacagatgtcccaaatgcaactatgttgtggacaacatagat
catctttatcccaacttcttagttaatgaattaattcttaaacagaagcaaagatctgag
gagaaaagactcaaactggaccattcagtgagtagcaccaatggccacaggtggcagata
attcaagatttgttgggaactgatcaagacaatcttgacttagctaatgtcaacctgatg
ctggagctgctggtgcaaaagaagaagcagttggaagcagagtctcatgctgcccaattg
cagatccttatggaattccttaaagttgccaggagaaacaaacgagagcaattggagcag
atccagaaggagctaagtgttctggaagaagatattaaacgtgtagaggagatgagtggc
ctgtactccccagtcagtgaggacagcacagtgccacagtttgaggctccctcaccttca
cacagtagtattattgactccaccgagtatagccagcctccaggcttcagtggcagttct
cagaccaaaaagcagccgtggtataacagcacgctggcctcgcggcgcaagcgcctcacg
gcccattttgaggacctggagcagtgctatttttccaccaggatgactcgtgtctcggat
gacagcagaaccaccagccagctggatgagtttcaggagtgtctgtccaagttcacgcgc
tacaattctgtccgaccgctggctacgctctcctacgccagtgacctctacaatggctcc
agcatagtgtccagtattgagttcgaccgagactgtgactactttgccatcgctggagtg
acaaagaagattaaagtctatgagtatggtacagtcattcaggatgcagtggatattcac
taccctgagaatgaaatgacctgtaattccaaaatcagctgtatcagctggagtagttac
cacaagaacctgctagccagcagtgactatgaaggcaccgtcatcctttgggatggattc
acaggacagagatccaaggtctaccaggagcatgagaaaaggtgctggagtgttgacttt
aacttgatggaccctaagctattggcttcaggctctgatgatgccaaagtgaaactgtgg
tctaccaacttggacaactcagttgcaagcattgaggccaaggctaacgtgtgttgtgtc
aaattcagcccatcttctaggtaccacctagcttttggctgtgcagatcactgtgttcac
tactacgacctgcgcaacactaagcagcccatcatggtgttcaaggggcaccgcaaggcc
gtctcctatgcaaagttcgtcagcggcgaagaaatcgtctctgcgtcaacagacagtcag
ctgaagctgtggaacgtggggaagcctcactgcctgcgctccttcaagggtcacatcaac
gagaagaactttgtggggctggcgtccaacggagactacattgcctgtggaagtgaaaat
aattccctttacttatactataagggcctctcaaagacactgctgacattcaagtttgat
acagtcaaaagtgttctggacaaggatcggaaagaagatgacaccaatgagtttgtgagc
gccgtgtgctggagggcacttccagatggggagtccaacgtgcttattgctgctaacagt
cagggtacaattaaggtactggagctggtatga

DBGET integrated database retrieval system