KEGG   Geospiza fortis (medium ground-finch): 102044448
Entry
102044448         CDS       T03755                                 

Gene name
PIDD1, PIDD
Definition
(RefSeq) p53-induced death domain protein 1
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
gfr04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102044448 (PIDD1)
   04115 p53 signaling pathway
    102044448 (PIDD1)
SSDB
Motif
Pfam: LRR_8 ZU5 Peptidase_S68 LRR_4 Death CARD_2
Other DBs
NCBI-GeneID: 102044448
NCBI-ProteinID: XP_005419561
UniProt: A0A6I9HGA0
LinkDB
Position
Un
AA seq 897 aa
MQKMAELLGLRDECGEGTLGAPALAGSCLADNRLNLDVYPDGCRRFLQLFKEQQGELVQV
EFLRLSSNDCLLDTTLDNLPHLKHLKSLVLKGGHARDKFGSYQHGSLTSLPPDFGNLRCL
THLDLSFNRLSTLPSCILHLPSLRVLLVSHNCLVTLPEDFGCLSKLTFFSAMKNQLKDLP
QSIGELSMLQDLDLSENALELLPEEVGNLHNCTELDLSGNCLSSIPDSLANLKSLRRLHL
HSNLLVTVPASLASLPNLSRLDLQNNCLRAIPAEIQALPFVHVRGNPLGETEPSPQADKS
STRRLKRHFLASGEGSFTVTSEGCRVVLACGIHFYFPPGAASAPLRIHFRSLTPDPQWVK
LRHHDVLLSRVLELQPHGIQFQQEVQIWMPYISPQTPHQHEVVVRTFSGQSWNDLKTRVK
QKRRSKKCVAHCCVLHFSWFLVVSRLVQNECKVPAEGTLLFSSVDPNIKVIFPPGVTEEP
RSVKLQVLPVSAEEIQEITAQAECRASPLLYLSQDSMVDFLKPVRIQLPLPPGVTGLNLD
RSRLHILHGDLEGQTWNDITSEVVLEFTHLYAMFEVTHFSWYWLWYTTKTYIGGIAKKVY
ERLRLYQVNFIALQRKRDPEQVLLQCVPKHKVDPVLKKLQDRYRGPEPSDMVEMFEGEQF
FAAFERGISIDMDRPDCVDGRLSFIFYSHLKNMKEIYVTSPVDRKGQAVKGQVSFYRGAV
PDSIPEDASRRRKGPDSLWLATLPIKLPQLKPRWDENPTPLYGFSFPPLNLGNAETGYLT
QANLLSIARRVGADWQSIGLNLGLTYQQIERIGYNNREDLNKQILDMLFSWAQQNSEDPD
CVSKLIRALKESGRQDIADEVEAIVELGRQKYSESIRRLGLEQESSTEDSAIAMIST
NT seq 2694 nt   +upstreamnt  +downstreamnt
atgcagaagatggcagagctgctggggctcagggatgagtgcggggaggggactttgggg
gctcctgccctggctggctcctgccttgctgacaacagactgaacctggatgtttatcct
gacggctgccgccgtttcctccagctgttcaaggagcaacagggagagctggtccaggtt
gagttcctccggctcagcagcaacgattgcctccttgacaccaccctggacaaccttcct
catctgaagcacctgaaatccctggtgcttaaaggtggccatgctagggataagtttggt
tcctatcagcatggctccctgacaagcttgccaccagactttgggaacctcaggtgtctc
acccacctggatctcagcttcaatagactctccaccttgccgagctgcattctccacctc
cccagcctccgtgtgctcctggtgagccacaactgcctagtgacacttcctgaggacttt
ggctgtctgagcaaactgactttcttctctgcaatgaaaaatcagctgaaggacttacct
cagagcattggggagctgtcaatgctgcaggatctggatctctcagaaaatgctttggaa
ttgctccctgaagaagttgggaatctgcacaactgcacagagctggatctctctgggaat
tgcttatcgagcatcccagactccctagccaatttgaagtctctgcgtcggctgcatctc
cacagcaatctcctggtgacagtccctgcctctcttgccagcctgcccaacttgtccaga
cttgatctgcagaacaactgtctccgtgccatccctgctgagatccaggccttgccgttt
gtgcacgtccgaggcaatcccttgggagaaacagaaccatccccacaggctgataaatcc
agtaccagaaggctaaaaagacacttccttgcatcaggagagggcagctttactgtcacc
tctgaaggctgcagagtggtcctggcctgtggcatccatttctactttcctccgggggct
gcctctgctcccctgcggatccacttccgatccctcacgccagatccacagtgggtaaag
ctgagacaccacgatgtcctgctcagtagagtcctggagctgcagcctcatggcatccaa
ttccagcaggaggtgcagatctggatgccatatatctcacctcaaacccctcaccagcat
gaggtggtggttcggaccttcagtgggcagagctggaatgatctgaaaacgagagtgaag
cagaagagaagatcaaagaagtgtgtggcccactgttgtgtccttcacttctcttggttc
cttgttgtgtctcgacttgtccaaaatgaatgcaaagtgccagcagaggggacattgctc
ttttccagtgtggatccaaacatcaaagtgatctttcctcctggagtcaccgaagagcct
cgtagtgtcaagctgcaggtgctgccagtctctgcagaagagatacaggaaatcacagcc
caagcagagtgcagagccagtcccctgctctacctctcccaggactccatggtggatttt
ctcaagccagtgagaattcagctgcctcttccccccggggtcacagggctaaatttggat
cggtcaaggctgcatatactccatggtgacctggagggccaaacctggaatgacatcacc
agtgaggtggtgctggaattcacccatctttatgcaatgtttgaagtcactcacttctcc
tggtactggctgtggtacactaccaagacctacattggaggcattgccaagaaggtctat
gagcggctgcgtctctaccaggtgaacttcattgcgctgcagaggaagagggatcctgag
caagtcctgctacagtgtgtccccaagcacaaggttgacccagtgctgaagaagctgcag
gaccgctatcgaggacctgagccatctgacatggtggagatgttcgagggagagcaattt
tttgcagcttttgagcgaggcatcagcattgatatggatcgccctgactgcgtggatgga
cgtctctcatttattttttactcccacttgaagaacatgaaggaaatctatgtgacctcc
cctgtggacagaaaaggccaagctgtaaaaggccaggtctctttctaccggggagcagtt
ccagacagcatccctgaagatgccagcaggaggagaaaaggtccagactccctctggctt
gctactctgcccatcaaactacctcaactgaaaccccggtgggatgagaaccccactccc
ctgtatggtttctccttccctcccttgaacctgggcaatgctgagactggctacctgaca
caggcaaacctgctgagcattgctaggcgcgtgggagctgactggcagagcatcggcctc
aacctgggcctgacctaccagcagattgagcgcataggatacaataacagagaggacctc
aataagcagatcctggacatgcttttctcatgggctcagcagaactcagaggatcctgac
tgtgtgagcaagctgatcagagccctcaaagagagtggccgccaggacatcgctgatgag
gttgaagccatcgttgagctggggcggcagaaatacagcgagtccatccgccggctgggc
ctggagcaggagagcagcactgaggactctgcaatagctatgattagcacctag

DBGET integrated database retrieval system