KEGG   Geospiza fortis (medium ground-finch): 102044449
Entry
102044449         CDS       T03755                                 

Gene name
CCNB2
Definition
(RefSeq) cyclin B2
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04068  FoxO signaling pathway
gfr04110  Cell cycle
gfr04114  Oocyte meiosis
gfr04115  p53 signaling pathway
gfr04218  Cellular senescence
gfr04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102044449 (CCNB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102044449 (CCNB2)
   04114 Oocyte meiosis
    102044449 (CCNB2)
   04115 p53 signaling pathway
    102044449 (CCNB2)
   04218 Cellular senescence
    102044449 (CCNB2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102044449 (CCNB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gfr03032]
    102044449 (CCNB2)
   03036 Chromosome and associated proteins [BR:gfr03036]
    102044449 (CCNB2)
DNA replication proteins [BR:gfr03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    102044449 (CCNB2)
Chromosome and associated proteins [BR:gfr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102044449 (CCNB2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102044449
NCBI-ProteinID: XP_005419736
UniProt: A0A6I9HFK3
LinkDB
Position
Un
AA seq 387 aa
MENAVSDLRSKAKTHVTGKRAALEEIGNKVATRGTHISKKTECPKASTKPVKGPSKVTNG
IVLPKAPAAVNQANKETDVPKVLSPVPMDVSMQEEDLCQAFSDVLLNNVEDIDAEDWENP
QLCSDYVKDIYLYLRELELQQSVRPHYLDGRTINGRMRAILVDWLVQVHSRFRLLQETLY
MCVAIMDRFLQNHPVPRKKLQLVGVTALLVASKYEEILSPDVADFVYITDNAYTSNEIRE
MEMIILKELNFDLGRPLPIHFLRRASKAGEADAKQHTLAKYLMELTLIDYDMVHHRPSEI
AAAALCLSQRILGHTKWGTKQQYYTGYAEDGLVMTMKHMAKNVVKVNEKLTKYTAIKNKY
ASSKLLTISTIPQLNSEIIKDLAASLL
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggagaatgctgtgtctgaccttagaagtaaagcaaaaactcacgtgactggcaaaagg
gctgctttggaagaaataggaaataaagttgcaacaagaggaacacacatatctaagaaa
acagaatgccccaaagcatctacaaagcctgtgaaaggaccaagcaaggtgacaaatgga
attgtactgcctaaagctccagctgctgtaaatcaagcaaacaaagaaactgatgttcca
aaggttctgtctcctgtccctatggatgtatccatgcaggaggaggatttgtgccaggcc
ttctctgatgtgctgctcaacaacgtcgaagacatcgatgcagaggactgggagaacccc
cagctgtgtagtgactacgtgaaagacatctacctgtacctgagggagctcgagctgcag
cagtctgtccgtccgcactacctggacgggaggacgatcaacgggcgcatgcgcgccatc
ctggtggactggctcgtgcaggtgcactcgaggttccgcctcctgcaggagaccctctac
atgtgtgtggccatcatggatcgcttcctgcagaatcatccagtacctcgcaagaagctt
cagctggtgggcgtaacagcgctgcttgtagcttcaaaatatgaagagatcttgtctcct
gatgtagcagactttgtttacattactgacaatgcctacaccagtaatgaaattagagaa
atggaaatgattattcttaaagaattaaacttcgacctggggcgacctcttccaattcat
ttcttaaggagagcatcaaaagctggggaggccgatgccaagcaacacactctggcaaaa
tatctgatggagctgaccctgatagactatgacatggtgcaccaccggccctcagagatt
gcagctgctgctctgtgcctgtctcagaggattctgggacataccaaatggggtacaaag
cagcagtactacacgggttatgcagaagacggccttgtgatgaccatgaaacatatggcc
aagaatgtagtcaaagtgaatgagaagttaacaaaatacactgctatcaagaacaagtat
gcaagcagcaaactactgaccatcagcaccatccctcagctgaacagtgagatcatcaag
gatctggctgcatcactgctgtga

DBGET integrated database retrieval system