KEGG   Geospiza fortis (medium ground-finch): 102044468
Entry
102044468         CDS       T03755                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00220  Arginine biosynthesis
gfr00330  Arginine and proline metabolism
gfr01100  Metabolic pathways
gfr04020  Calcium signaling pathway
gfr04146  Peroxisome
gfr04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102044468 (NOS2)
   00330 Arginine and proline metabolism
    102044468 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102044468 (NOS2)
   04020 Calcium signaling pathway
    102044468 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102044468 (NOS2)
Enzymes [BR:gfr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102044468 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 102044468
NCBI-ProteinID: XP_014163841
LinkDB
Position
Un
AA seq 1121 aa
MLCPWQFVFKSHAARSQYPREKDINNNVEKNRKIHGSEKDDAKLHNPSKKQMERLPIITS
AKPSEGGENLPPNDIKVSNQISGCPRHVRVRNLENGSSFLDTLHLTAKEVINCQTKACQG
SLMTPKGLVRGTRDGPVPPEDLLPQARDFLKQYYSSFKEPKIKEQLGRLEAVTKEIERTG
TYHLTKDELTFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFEHICHHIQYATNN
GNIRSAITVFPPRTDGQHDFRVWNSQLIHYAGYHMPDGSVLGDPATVEFTQLCIELGWKP
KFGRFDVLPLVLQANGQDPEIFELPPEIVLQVPMEHPKYEWFKELELKWYALPAVASMLL
EAGGLEFTACPFNGWYMGTEIGVRDFCDAQRYNVLKEVGRRMALETNKLSSLWKDRAVVE
INVAVLHSFQKQNVTIMDHHSASESFLKYMQSEYRARGGCPADWVWIVPPMSGSITPVFH
QEMLNYVLTPFYYYQVDAWKTHVWHDETRRPRKKEIKFSILAKAVLFASSLMRGVVATRA
KVTVIFATETGKSETLANNLCSLFSCAFSTKILCMDEYNICDLENETLLLVVTSTFGNGD
SPGNGKALKDSLLRLKLLRNKIRYAVFGLGSSMYPEFCAFARAIDQKLAQLGASQLTPVG
EGDELNGQEEAFRTWAVSAFKAACDIFNVRGRHSIQLPEIYTSEESWDPTSYRVVHDSQP
MDLAKALTNIHTKDVIPMKLKFRQNLQSSKSSRVTILVKLQCETNQEVYYLPGDHIGIFP
GNQAELVHGIIARVKDAPPAGQTIRLETCIDGGYWASHKKIPACTLPEALTYLLDITTPP
SQQLLKKFSQLVTTEGDKQRLEVLCQVKEYNKWKFYNSPNILEVLEEFPSSCDMTAREIH
LTVAVVNYRTRDGEGPLHHGVCSTWLNTIELNETVPCFIRSANEFHLPEEPAKPCILIGS
GTGIAPFRSFWLQRLHDLEHRGLRGGDMTLLFGCRQPDLDHIYREETEEMKRRGVLRDVY
TAYSRLPGQEKVYVQDILQGQLEARVCEVLHGQQGHVYVCGDVRMARDVAAALRQPVSSR
LAAFHSSLGCPFFLQSQKRYHEDIFGAVFPHEVKRALQPTS
NT seq 3366 nt   +upstreamnt  +downstreamnt
atgctgtgcccgtggcagtttgtgttcaaatctcatgctgccaggagccagtaccccagg
gagaaggatatcaacaacaacgtggagaaaaataggaagatccatggctcagaaaaggac
gatgccaaattgcacaatcccagcaagaagcagatggagaggctgcctatcataacttca
gcaaagcccagtgagggaggagagaatctccctccaaatgacatcaaagtttcaaaccaa
atatcaggatgtccaagacatgtaagagtaagaaacttggaaaatggatccagctttctt
gacacactacacctgactgcaaaagaggttatcaactgccagaccaaagcctgccaaggg
tcactcatgaccccaaagggcctggtgagaggtaccagagatgggccagttccaccagag
gatcttttacctcaggcaagagacttcctcaagcaatattacagttcatttaaagagcca
aaaatcaaagaacagctgggccggctggaagcagtgaccaaggagatagaaagaacagga
acctaccacctgacaaaggatgagctgacctttgctgccaagcaggcctggaggaatgca
cccaggtgcatcgggagaatccagtggtccaacctgcaggtatttgatgcacgggactgt
aaaacagccaaggaaatgtttgagcatatctgtcatcatattcagtatgccacaaacaat
ggcaatataaggtcagccatcacagtgttcccaccccggacggatgggcagcacgatttc
cgcgtgtggaacagccagctgatccactacgctggctaccacatgccagatggctctgtc
cttggggaccctgccactgtggagttcactcagttgtgcatcgagcttgggtggaagccg
aaatttggccgctttgatgtacttccacttgttctccaagcaaatggccaagacccagaa
atatttgaattacctccagaaattgtcctccaagtgccaatggagcatccaaagtacgag
tggtttaaggagctggagctgaagtggtatgcgctgcctgcggtggccagcatgctgctg
gaggcgggagggctggagttcaccgcgtgccctttcaacggctggtacatgggcaccgag
atcggagtgcgcgacttctgcgacgcgcagcgctacaacgtcctgaaggaggtagggagg
agaatggcactggaaacaaacaaactgtcatcattatggaaggaccgagctgttgtagag
atcaatgtggctgtgcttcacagcttccagaaacagaatgtgaccatcatggatcaccac
tctgcctctgagtccttcctgaagtacatgcagagcgagtaccgtgcgcggggcggctgc
ccggctgactgggtgtggattgtgcctcccatgtcaggcagcataacccctgtcttccac
caagagatgttgaactatgtcctcactcccttctattactaccaggtggatgcatggaaa
acacatgtgtggcatgatgagacccggaggccaaggaaaaaagaaataaagtttagcatc
ttggcaaaggctgtgctctttgcatcctcgctcatgcgaggagtggtggccaccagggcc
aaggtcaccgtgatcttcgcgacagagacgggcaagtcagagaccctggccaacaacctg
tgcagcctgttcagctgtgccttcagcaccaagatcctgtgcatggatgagtacaatatt
tgtgacctggaaaatgaaacacttcttttagtggttactagcacttttggaaatggagat
tctccaggtaacggaaaggccttgaaggactccttgctcagactgaaactgctgagaaat
aaaattaggtatgctgtgtttggtctggggtccagcatgtacccagagttctgtgccttt
gctcgtgccattgaccaaaaactggcccagctcggggcttcccagctcactccagtgggt
gaaggggatgagctcaatgggcaagaagaagcgttccgcacctgggcagtcagtgctttc
aaggctgcctgtgacatttttaacgtccgtgggagacacagtattcagttgcctgagatc
tacacctctgaggaaagctgggaccctaccagttacagagtagtgcatgactcccagccc
atggacctggctaaagctcttacaaacattcataccaaggatgtaattcccatgaagctg
aaattcaggcagaatcttcaaagttcgaagtccagtcgtgtcaccattctggttaaactt
cagtgtgagactaaccaggaagtgtactaccttcctggggatcacatcgggattttccca
ggcaaccaggcagaattagtccatggcatcattgcacgtgtcaaggacgcccctccagct
ggtcaaaccatcaggcttgaaacctgcattgatggtgggtactgggcaagtcacaaaaag
attccagcctgcacgctacctgaggctttgacatacttgctcgatatcactactccaccc
tcccagcaactgctaaaaaaattctcccagctggtgacaacagaaggagacaagcagagg
ttggaggtgctgtgtcaggtgaaggaatacaataaatggaagttttacaacagcccaaac
atcctggaggtcctggaggagttcccctcttcctgtgacatgacagccagagagatccat
ctgacagttgcagttgtaaactacaggacaagagatggagaagggcctttgcaccatgga
gtctgcagcacgtggctgaacacaatagagctcaatgaaactgttccctgcttcatccgc
agtgctaatgagttccacctccccgaggaaccagccaagccctgcattctgatcggctcg
ggcacgggcattgctcccttcaggagcttctggctgcagcgcctccatgacctggagcac
agagggctcagaggaggggacatgaccttgctgttcggctgccggcagccagacctggac
cacatctacagggaggagactgaggagatgaagaggaggggagtcctgagagatgtctac
acagcttactccagactgcctggccaagagaaagtctatgtccaggacatcctgcagggg
cagctggaggcccgcgtgtgcgaggtgctgcacgggcagcagggccacgtctacgtgtgc
ggggacgtgcgcatggcgcgggacgtggccgcggcgctgcggcagcccgtgagctcccgt
ctggcagcatttcattcatctcttgggtgtcctttctttttgcagagccaaaagcgatac
catgaagatatatttggggctgtgttcccacatgaagtcaaaagagctttgcaacccacc
agctga

DBGET integrated database retrieval system