KEGG   Geospiza fortis (medium ground-finch): 102044501
Entry
102044501         CDS       T03755                                 

Gene name
AFDN, MLLT4
Definition
(RefSeq) afadin, adherens junction formation factor
  KO
K05702  afadin
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04520  Adherens junction
gfr04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102044501 (AFDN)
   04530 Tight junction
    102044501 (AFDN)
SSDB
Motif
Pfam: RA DIL PDZ PDZ_6 FHA PDZ_2 Yop-YscD_cpl
Other DBs
NCBI-GeneID: 102044501
NCBI-ProteinID: XP_005416333
LinkDB
Position
Un
AA seq 1784 aa
MRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEE
RRLDVDEKPLVVQLNWNKDDREGRFVLKNENDTLPPKKAQSNGPEKQEKEGVIQNFKRTL
SKKEKKEKKRREKEALRQASDKDDRLLHGDDIENFRLAAEVYKDMPETSFTRTISNPEVV
MKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVIEA
LEKYGLEKENPKDYCIARVMLPPGAQHSDDKGAKETILDDDECPLQIFREWPSDKGILVF
QLKRRPPDYVPKKTRKIADGKPLKGKERVDGSGYGSCLPPEKLPYLVELSPGRRNHFAYY
NYHTYEDGSDSRDKPKLYRLQLSVTEVGTEKFDDNSIQLFGPGIQPHHCDLTNMDGVVTV
TPRSIDAETYVEGQRISETTMLQSGMKVQFGSSHVFKFVDPTQDHIISKRSTDASLMVKG
PRHKTGAVQETTFDLEGDIHSGTALPASKSTSRLDGDRASSASSTAERGMVKPMIRIDQQ
DYRRQDSRSQDTHGPELILPASIEFRESSEDAFLSAIINYTNSSTVHFKLSPTYVLYMTC
RYVLSSQYRPDITPAERTHKVIAIVNKMVNMMEGVIQKQKNIAGALAFWMANASELLNFI
KQDRDLSRITVDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENNPQRPKIDDV
LHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTAPDSGLCSHYWGAIMRQQ
LGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSHADVPNINSTCFKLNSLQLQALL
QNYHCAPDEPLIPTELIENVVTVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSC
DVVRNVPSGLQEFLDPLCQRGFCRLIPHPRSPGTWTIYFEGADYESHLSHENAELAQPLR
KEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVD
GRSLVGLSQERAAELMTRTGSVVTLEVAKQGAIYHGLATLLNQPSPMMQRVSDRRGSGKP
RPKSEGFELYNNSTQNGSPESPQLPWTEYSEPKKLPGDDRLMKNRADHRSSPNVANQPPS
PGGKNAYASGTTTKITSVSTGNLCTEEQILPPRPEAYPIPTQTYTREYFTFPASKSQDRM
GPAQSQWPSYEEKPQLQAESNHSINTTMQRVARSQEELRDKVFQPERNRLEVVIRKDVEY
IDRKSDSDQWMNSSVDSSTSSQEHLNHSSKPVSPGSCLTKSGPGRWKTPATSQPTPVAIS
QPIRTDLPPPPPPPPVHYAAEFDELQMDLPLPPPPPPNQIGAQASSQVAAAERKKREEHQ
RWYEKEKARLEEERERKRREQERKLGQMRSQPLIPAQPVVPPVSLQQVKSEKPSTLQRPQ
ETVIRELQPQQQPRTIERRDLQYITISKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVD
MLSKEIQDLQNKPDRTAEENDRLRKLMLEWQFQKRLQESKQKDEDDDEEEDDEVDTMLIM
QRLEAERRARDEERRRQQQLEEMRKREAEDRARQEEERRQQEEERTRREAEEKRRQEEEY
YSRLEAERRRQHDEAERRLLEPDEPGLYRPPLPREYELPSPTPSSNAPPPPPQRNTSYLK
TQVLSPDTIYTAKFVAYNDDDDEEEDSNLAGINSYTGSTGAAAGEVYQDPRDKRSKSQDA
DLPGAPENLTFRERQRLFSQGQDVSNKVKASRKLMELENELNTK
NT seq 5355 nt   +upstreamnt  +downstreamnt
atgagattctactttcaagacaaagcagctggaaattttgcaacaaaatgtatccgtgtc
tctagtactgccacaactcaagatgtcatagaaactcttgcagagaagtttcgaccagac
atgcgaatgttgtcatcccctaaatactcactttatgaagtacatgtcagtggagaagaa
agaagattagatgtggatgagaagcctcttgttgtacagttaaactggaacaaagatgat
cgcgagggaaggtttgtcctcaagaatgaaaatgatacacttcctccaaagaaagctcag
agtaatgggcctgaaaaacaagaaaaagagggagtaattcagaatttcaagcgaactctc
tcaaaaaaagaaaaaaaggaaaaaaagaggcgtgaaaaagaggcattgcgacaagcgtca
gataaagatgatagacttcttcatggggatgatattgagaattttcgccttgcagctgag
gtttacaaagatatgcctgagaccagcttcactcgcacaatatccaatcctgaggtggtt
atgaaacggcgacgacagcaaaaactagagaagagaatgcaggagtttcgcagttctgat
ggcagaccagactcaggtgggacgctgagaatttatgcagacagtttaaaaccaaatata
ccgtacaagacaatcctgctgtctactacagatactgcagactttgcagttattgaagca
ctggaaaaatatggcctggaaaaagaaaatcccaaggattattgtattgctcgtgtcatg
ctgcctcctggtgctcagcattctgatgataaaggtgctaaagaaactattcttgatgat
gatgagtgtccactgcagatatttagggagtggcctagtgataaaggaatactggtcttt
cagttgaaaaggcggcctcctgattatgtcccaaagaaaaccaggaagatagctgatgga
aaaccattgaaggggaaggaaagagttgacgggtctggctatggctcttgccttcctcct
gagaaactaccatacctggtagaattaagcccagggagaaggaatcactttgcctactac
aactatcacacttacgaagatggttctgactccagagataagccaaagctctatcgtcta
caattaagtgtcactgaagttggaactgaaaaatttgatgacaattccattcagttattt
ggtccaggaattcagcctcatcactgtgacctcactaatatggatggagttgtcactgta
accccgagaagcattgatgctgaaacctatgtggaaggtcagcgtatttcagaaaccacc
atgttgcaaagtggaatgaaggttcaatttgggtcttctcatgtatttaagtttgtggat
cctactcaggaccatattatttccaaaagatctactgatgcaagtcttatggtcaaaggt
ccaagacacaaaactggagctgtccaggaaaccacatttgatctggagggagatattcac
agtggaacagcattaccagcaagcaagagcaccagcaggctggacggtgacagggcatca
tccgcatccagcacagccgagcgaggaatggtgaagccaatgattaggatagaccagcag
gattaccgccgacaggacagcagatctcaggatacccatggaccagaactgatactgcct
gccagtattgaattcagggaaagctctgaagatgccttcttatctgccattataaattac
acaaatagctcgacagttcattttaagctgtcaccaacatatgttttgtatatgacatgt
cggtatgtattgtccagccaatacagacctgacatcactcctgctgagcgtactcacaaa
gtcattgcaatagtcaacaagatggtgaacatgatggaaggagtgatacagaaacagaag
aatattgctggggcccttgccttttggatggcaaatgcatctgaactactcaatttcata
aagcaagacagagatcttagccgaattactgtggatgcacaagatgttttggcacacttg
gttcaaatggcattcaagtacctggttcattgtctgcagtcagagcttaataactacatg
ccagcattcctggatgatccagaggaaaataatcctcagaggcctaaaatagatgatgtg
ctgcataccttgactggagccatgtccctgttgcgacgatgcagagtaaatgctgctctg
accatacagctcttctcccagctctttcattttatcaacatgtggctttttaacagatta
gttacagccccagattcagggttatgttcacattactggggagctatcatgcgccaacag
cttggccacattgaggcctgggcagaaaaacagggtttggaattggctgctgattgccac
ctgagcagaatagtacaggcaaccacattgcttaccatggacaaatactcacatgcggat
gttccaaatattaacagtacttgctttaagctgaattctctgcagctacaagccttgttg
cagaattatcactgtgctccagatgaaccactcatcccaacagaattgatagagaatgta
gtaactgttgcagaaaatacagctgatgaacttgctcgcagtgatggccgagaagtccag
ctggaagaggatcctgacttacagctaccttttctcttaccagaagatggctattcctgt
gatgttgtcagaaatgttccaagtggtttacaagaatttttagatccactctgtcaaaga
ggcttttgtagactaatacctcatccacggtcaccaggcacatggacaatatactttgaa
ggtgcagattacgaaagtcacctgtcccatgagaatgctgagctggctcagcctttgaga
aaagaacctgaaattatcactgtaacactaaaaaaacaaaatggaatgggactgagcatt
gttgctgccaagggtgctggtcaagacaaacttggaatatatgtcaagtctgttgtgaaa
ggaggtgctgcagatgtggatggtcgtctggctgcaggggatcagttgcttagtgtggat
ggtcgaagtttggtgggcctgtcccaggagagggcagcagaacttatgactaggacaggt
tctgtagtaacactagaagtagcaaaacaaggagcaatttaccatggcctggcaaccctg
cttaatcagccatccccaatgatgcaaagagtttctgaccgccgtggctcaggtaaacct
cgaccaaagagtgaaggttttgagctgtataacaattccacgcaaaatggatcacctgag
agtccccagctgccctggacggagtacagtgagccaaagaagctgccaggggatgacaga
ttgatgaagaacagggcggatcatcgttccagtcccaatgtagcaaatcagcctccaagc
cctgggggaaagaatgcttatgcatctggaactaccaccaaaataacctcagtctctact
ggaaatctttgtacagaggaacagattctgccaccacgacctgaagcttatcccatccca
acacagacctatactagagaatatttcacattcccagcttcaaagtcgcaggatcgaatg
ggtccagctcagagtcagtggccaagttatgaagaaaaaccacagcttcaagcagaaagt
aatcattctatcaatactaccatgcagcgtgtagctcgttcccaagaagagctcagagac
aaagttttccagccagagaggaatcgtttggaagttgttatacgcaaggatgtggagtac
attgatcggaagtcagacagcgatcagtggatgaattcatctgtggattctagcacatct
agccaggaacacctgaaccattcctccaaaccagtgtcacctggttcttgtctaactaaa
agtggacctggccgttggaaaactccagccactagccagccgactccagtggccatttcc
cagcccatcagaacagatcttccccctccaccaccacctcctccagtgcattatgctgct
gaatttgatgaactacaaatggatttgcctctgcctccacctcctcctccaaatcagata
ggagcacaagcatcctcccaggtagctgctgctgagcgtaaaaaaagagaagagcatcag
aggtggtatgaaaaggaaaaggcacgtttggaagaagaacgagaaaggaaacgtcgtgag
caggaaagaaaactgggccaaatgcgttctcagccactaattcctgctcagcctgtggtt
cctcctgtctcccttcaacaagtgaaatcagaaaagccctcaactttgcagaggcctcaa
gaaacagttattcgagagctgcagccccaacagcagccgcggactattgagcggagagac
ctgcagtacattaccatcagcaaggaagaactgtcctctggtgatagcctctctccagat
ccatggaaacgggatgcaaaggagaagctggagaagcagcaacagatgcacatcgtggac
atgctgagtaaagagattcaggaccttcagaacaaacctgatcgtacagcggaagaaaac
gaccgcctccgcaaactcatgcttgagtggcagttccaaaagcgactgcaagaatcaaag
caaaaggatgaagatgacgatgaagaggaggatgatgaggtggatactatgctcatcatg
cagcgactggaggcagaaagaagagcaagggatgaagaacgcagacggcagcaacaattg
gaagaaatgcgtaaacgagaagcagaagacagagccaggcaggaagaagagcgcagacag
caagaggaggagcggaccaggagagaggctgaagaaaagaggcgccaggaagaggagtat
tacagtcgcttagaggctgaaaggcgcaggcagcacgatgaagctgagcgaagattgctg
gaacctgacgagcctggtctgtacagacctccgcttccacgggaatatgaactcccatcc
ccaaccccttcatctaacgctcctcctcccccacctcagcgaaacacctcttacctcaaa
acacaggtcctctcccctgacacgatttatactgccaagtttgttgcttacaatgatgat
gatgatgaggaggaggattccaatctagcaggaataaattcatacactggatctacagga
gcagctgctggggaagtttatcaggatccaagagacaaaagatctaaaagtcaagatgcc
gatttacctggagcaccagaaaacctgacgttcagggaacgccagcgacttttttcacag
ggtcaggatgtatccaataaagtaaaagcttctaggaaactaatggaactggaaaatgag
ttgaacacaaaataa

DBGET integrated database retrieval system