KEGG   Geospiza fortis (medium ground-finch): 102044546
Entry
102044546         CDS       T03755                                 

Definition
(RefSeq) caspase-8-like
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
gfr04210  Apoptosis
gfr04217  Necroptosis
gfr04620  Toll-like receptor signaling pathway
gfr04621  NOD-like receptor signaling pathway
gfr04622  RIG-I-like receptor signaling pathway
gfr04625  C-type lectin receptor signaling pathway
gfr05132  Salmonella infection
gfr05164  Influenza A
gfr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102044546
   04217 Necroptosis
    102044546
   04115 p53 signaling pathway
    102044546
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102044546
   04621 NOD-like receptor signaling pathway
    102044546
   04622 RIG-I-like receptor signaling pathway
    102044546
   04625 C-type lectin receptor signaling pathway
    102044546
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102044546
  09172 Infectious disease: viral
   05164 Influenza A
    102044546
   05168 Herpes simplex virus 1 infection
    102044546
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gfr01002]
    102044546
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     102044546
Peptidases and inhibitors [BR:gfr01002]
 Cysteine peptidases
  Family C14: caspase family
   102044546
SSDB
Motif
Pfam: Peptidase_C14 DED PYRIN
Other DBs
NCBI-GeneID: 102044546
NCBI-ProteinID: XP_005415992
UniProt: A0A6I9HBF5
LinkDB
Position
Un
AA seq 480 aa
MALPQGRLLAVGDELDGAELAALKFLCRDHVPWRRLEAVRTPHDLFEALQEKGLLEPGDL
AFLRELLYRIGRIDVLVAHLGSSREQVERELRAPGGARVPPFRYLLFQLYEDVTEDELMY
FKLLLGNKLPKSKLTHETTMLDILTEMEKKGLLGKDNLSMLKSLCEKINISLWNRIEDGL
KLFGQEEMLITEEQRVSTGYPERHPVSSVAPGPPGSFNDSSQLLEAYKMTSRPCGVCLIL
NNHNFAKAREGVLEHKHMKDRNGTDVDAAALRNVFSKLHFTVEECRDLTAEEIRETVNIF
RSADHEDKDCFVCCILSHGKKGIIYGVDGQEVPIRELTTSFTAQNCNSLAGKPKVFFIQA
CQGDAFHQGVTIETDSGEQDSSVERDARLQLECIPAEADFLLGMATLQDYVSYRSPKEGT
WYIQALCQHLEYSCPRGEDILTILTAVNQEVSRKTCERGTKKQMPQPSFTLRKRLIFPVN
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggcgctgccccagggacggctgctggcggtcggcgacgagctggacggggccgagctg
gcggcgctgaagttcctctgccgggaccacgtgccctggagaaggctggaagccgtccgg
acccctcacgacttgttcgaagcgctgcaggagaagggcttgctggagccgggagacctg
gccttcctcagggagctgctctaccgcatcgggcggatcgacgtcctggttgcccacctg
ggctccagccgggagcaggtggagagggagctgcgggcgccgggcggggcgcgggtgccg
cccttcagatacttgctctttcagctgtacgaagatgtcaccgaagatgagctaatgtat
ttcaagttacttttgggcaacaaattgccaaaaagcaagctaacccatgagactacaatg
cttgacattctcactgagatggagaagaagggccttctggggaaagacaacttaagtatg
ctgaagagtctctgtgaaaaaattaacatcagcctgtggaacagaattgaagatggatta
aagctgtttggccaagaagaaatgctcatcacagaggaacagagggtcagcacaggatac
cctgagcgacatccggtgtcatctgtagcacctggtcctcctggcagttttaatgactct
tcccagctgcttgaagcttacaaaatgaccagccgaccctgtggagtgtgcctgatcctg
aataatcacaattttgcaaaagctagagaaggagtgctggaacacaaacacatgaaggat
cggaatgggacagacgtggatgcagcggctctgaggaatgtctttagcaagcttcatttt
acagtagaagaatgtagagacctcactgcagaagaaatccgtgagactgtgaacatcttc
cggagtgcagaccatgaggacaaggactgttttgtttgctgtatcctgtctcatgggaaa
aaaggcattatatatggtgttgatgggcaggaagtacctatcagggaactgaccacttct
ttcactgcacagaattgcaattcacttgctggaaaaccaaaagttttttttattcaggcc
tgccaaggtgatgctttccatcaaggtgtgaccatcgaaacagattctggagagcaagat
tcttctgtggagcgagatgcgaggcttcagctcgagtgcatccctgcagaggcagacttc
ctcctgggcatggccaccctgcaggattacgtctcctacagaagtcccaaggagggaacc
tggtacatacaggcactgtgccagcacttggagtacagctgtcctcgaggggaagatatt
ctcaccatcctgacagcagtaaatcaagaagtgagcagaaaaacttgtgagcggggcaca
aagaagcagatgccacagcccagtttcaccctgaggaagaggctcatctttcctgtcaac
taa

KEGG   Geospiza fortis (medium ground-finch): 102044717
Entry
102044717         CDS       T03755                                 

Definition
(RefSeq) caspase-8-like
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
gfr04210  Apoptosis
gfr04217  Necroptosis
gfr04620  Toll-like receptor signaling pathway
gfr04621  NOD-like receptor signaling pathway
gfr04622  RIG-I-like receptor signaling pathway
gfr04625  C-type lectin receptor signaling pathway
gfr05132  Salmonella infection
gfr05164  Influenza A
gfr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102044717
   04217 Necroptosis
    102044717
   04115 p53 signaling pathway
    102044717
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102044717
   04621 NOD-like receptor signaling pathway
    102044717
   04622 RIG-I-like receptor signaling pathway
    102044717
   04625 C-type lectin receptor signaling pathway
    102044717
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102044717
  09172 Infectious disease: viral
   05164 Influenza A
    102044717
   05168 Herpes simplex virus 1 infection
    102044717
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gfr01002]
    102044717
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     102044717
Peptidases and inhibitors [BR:gfr01002]
 Cysteine peptidases
  Family C14: caspase family
   102044717
SSDB
Motif
Pfam: DED Peptidase_C14 PYRIN
Other DBs
NCBI-GeneID: 102044717
NCBI-ProteinID: XP_005415993
UniProt: A0A6I9HBV8
LinkDB
Position
Un
AA seq 464 aa
MSTDFRKLLFEVSEALVTEEVSALKFLSQDHVPRGKLEAIHEPKAFFEVLQEKDMIGAGN
LFFLKELLYRIHRIDLLTARLGSSREEMERELQVPGRAQVSDYRQLLYGIAEDLTSEDVR
NVKFLLRKQLPKNKLQENASMLQVFLEMEINEKIKEDNLTMLKDILQGFRADIKKKIDAY
EEKRREKYSREEVRYPVSVYPEEQGAEGEAEAAKQYGKIYKMKNNPHGYCLIINNHIFKN
PCHNREGTLQDGEAVKRVFKWLQFETVEHMDLEGKKIYDTVEEYSKKDHRNMDCFVCFIF
SHGEKDKIKGVDDECVNIEDLVSRFTGTNCPSLAGKPKVFIIQACQGSEHHPSVAVESDS
SGHLEVDASPLTSIPDRADILIGMATVEDYLCYRSPKTGSVYIQSLCEKMESLCPQYVDL
ATILTEVNSEVATKDIKGFKQMPKITSTLLKLLIFEVPQCKADK
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagtacagacttccgcaaactgctttttgaagtttctgaggctttggtgacagaggaa
gtgtcagctcttaaattcctcagccaggaccatgtccccagggggaagctggaagccatc
catgagcccaaggccttctttgaagtgctgcaggagaaagacatgatcggggcagggaac
ctgttcttcctgaaggagctgctctaccggatccatcggatcgacctcctgactgcccgc
ctgggctccagccgtgaggagatggagagggagctgcaggtcccgggcagggctcaggtg
tcagattacaggcaactgctgtatggaattgcagaggatttgacttcagaagatgtcaga
aatgtgaagttcctgctccgaaaacaactaccaaagaacaagctccaggaaaatgcttca
atgttgcaggtctttctggaaatggaaattaatgagaaaattaaagaagataacctgaca
atgctgaaagatatattacagggatttagagctgacataaagaaaaaaattgatgcctat
gaagaaaaaagaagagaaaagtattctagggaagaagtccgctatcctgtgtctgtgtac
ccagaggaacaaggagcagagggggaggcggaggcagcaaaacagtatgggaaaatatat
aagatgaaaaataacccccatggttactgcttaattattaacaaccacatttttaaaaat
ccatgtcacaatagagagggaacattgcaagatggagaggctgtgaagagggtctttaag
tggcttcagtttgagacagttgagcacatggatctagaaggaaaaaaaatatatgacaca
gttgaagaatacagtaagaaagatcatagaaatatggactgttttgtttgcttcattttc
tcccatggtgaaaaagacaaaataaaaggtgttgatgatgagtgtgtaaatattgaagat
ttagtctcccgcttcactggaactaattgtccttctcttgctggcaaacccaaggtgttt
attatccaggcttgccaaggctctgaacatcatccatctgttgcagtagaatcagactct
tctggacatcttgaggtggatgctagtcctttgacttccattcctgatagggctgatatt
ctgattggcatggctacagtggaggactacttgtgctaccgcagtcctaagactggcagt
gtttacattcaatccctctgtgagaagatggagtcgctttgcccacagtatgtggatctt
gcaaccatcctgacagaagtgaacagtgaagtggccacaaaagacataaaaggatttaag
caaatgccaaagataacatcgacactactgaagctattgatctttgaagttccacaatgc
aaagcagacaagtaa

DBGET integrated database retrieval system