KEGG   Geospiza fortis (medium ground-finch): 102044562Help
Entry
102044562         CDS       T03755                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00052  Galactose metabolism
gfr00500  Starch and sucrose metabolism
gfr01100  Metabolic pathways
gfr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102044562
   00500 Starch and sucrose metabolism
    102044562
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102044562
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gfr04147]
    102044562
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102044562
Exosome [BR:gfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102044562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 RL11D
Motif
Other DBs
NCBI-GeneID: 102044562
NCBI-ProteinID: XP_005420416
LinkDB All DBs
Position
Un
AA seq 926 aa AA seqDB search
MKSYQKLTAAQPAACRVEEEGAAPVPSGHGKLAPWWVGSGLLVAAVLLSTITVWVLRQVS
GGWLGPTAPPKCLVVPESQRFDCYPERRVVVTQELCESRGCCFIQSPPLAEGKQGVPWCF
YPPDFPSYTLESLNQTALGMVGLLVRREKAYYPRDIQKLRLDVEFETDTRLHIKITDAAN
PRYEVPLDVPRVMKRAENPTYSLNFSWDPFGVLLQRKATGTVLLNTTVAPLIFADQFLQI
STSLPSKFLYGLGEHRGSLLHSLDWNTLTLWARDVSPTESFNLYGAHPFYLLMEEGGNAH
GVFLLNSNAMEVALQPAPGLTWRTIGGVLDFYIFLGPDPNMVIQQYQQVIGFPAMPPIWA
LGFHLCRWGYGSSNRTWQTVRAMRNYQIPQDGQWNDIDYMDGYRDFTLDSQKFASLPSLV
EDLHKHGQHYVMILDPGISSTSPHGSYWPFDEGLRRGLFLNTTQGQPLIGQVWPGFTAFA
DFSNPDTHQWWLENLQHFHAHVPFDGLWIDMNEPSNFMDGSEDGCPPGELDNPPYTPAVL
GDSLSAKTVCASAKQKISVHYNLHNLYGLMEAKATASALIQIRGKRPFLISRSTFPSQGR
YSGHWLGDNRSQWKDMHYSIPGLLSFSLFGIPLVGADICGFSGSTSEELCTRWMQLGAFY
PFSRNHNTQNEKAQDPTVFSPAARTAMKDVLLTRYSLLPFLYTLFHRAHLQGDTVARPLF
FEFPQDEATWELDRQFLWGQSLLVTPVLEPGVDSVTGYVPQGTWYDFYTGSSVSSSGEML
KMSAPLEHLNLHIREGSILPTQKPGTTTEATRGNPLRLIVALSSHATAWGDLFWDDGESL
DTFEKGNYSYVVFNVTQNIFTSTVLHATTEATKVTVGTLSIFGVQKPPSKVLLNGQEKPF
SYLDNQVLNVSDLGMSLSQGFSLQWL
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgtaccagaagctgacagcagcccagccagcagcgtgccgggtggaagaggag
ggggctgccccggtgccctccggccatgggaagctggccccgtggtgggtgggcagcggg
ctgctggtggccgctgttctgctgagcaccatcactgtctgggtgctgcggcaagtgtcg
gggggctggctgggacccacagcacccccaaaatgcctcgtggtccccgagagccagcgc
tttgactgctacccggagcggcgcgtggtggtgacccaggagctctgcgaaagccgaggc
tgctgcttcatccagagtcccccgctggcagagggcaagcagggggtgccctggtgcttc
tatccccctgacttccccagctacaccctggagagcctcaaccagacagcgctgggcatg
gtggggctgctggtgcggagggagaaggcctattacccccgggacatccagaagctgagg
ctggatgtggagtttgagacggacacacggctgcacatcaagataacagatgcagccaac
ccacgctatgaggttccccttgatgttccccgggtgatgaagagagcagaaaaccccacc
tacagtttgaacttctcctgggacccctttggggtgctgctgcagcgcaaggcaacaggg
acagtgctgctaaacaccaccgtggcccccttgatctttgctgaccagtttctccagata
tccacatcactgccatccaagttcctctatgggctgggggagcaccgtggcagcctcctg
cacagcctggactggaacaccctcacactgtgggcccgtgacgtctctcccacggaatca
ttcaacctgtatggtgctcaccccttctacctgctgatggaggagggtggaaatgctcac
ggtgttttcctgctcaacagcaacgccatggaggtggctctgcagcctgctccaggcctg
acctggagaaccattggaggggtgctggatttttacatcttcctggggcccgatcccaac
atggtcatccagcagtaccagcaggtgataggtttcccagccatgccccccatctgggct
cttggcttccacctctgccgctggggctacggatccagcaacaggacctggcagactgtg
agagccatgaggaactaccagatcccccaggatgggcagtggaatgacatcgattacatg
gatgggtaccgggacttcaccttggattcccagaagtttgcctccctgccctccctggtg
gaagatctccacaaacacgggcagcactacgttatgatcttggatcctggcatcagcagc
accagcccccacggctcctactggccttttgatgaaggcttgagacggggcttgttcctc
aacaccacccaagggcagccactcatcgggcaggtctggcctggtttcactgcctttgca
gacttctccaacccagacacacaccagtggtggctggagaacctgcagcacttccatgcc
cacgtgccctttgacggcctctggatcgacatgaatgagccatccaacttcatggatggg
tctgaagatggctgccccccaggagagctggacaacccaccctacactccagccgtgctg
ggcgattccctctctgcaaagacagtgtgtgcctcagcaaagcagaaaatctccgtgcac
tacaacctccacaacctctatgggctgatggaagccaaagccacagcaagcgccttgatc
cagatccgggggaagcgccccttcctcatctcccgctccaccttccccagccagggccgc
tactcggggcactggctgggtgacaaccggagccagtggaaggacatgcattactcaatc
ccagggctgctgagcttcagcctctttggcatccctctggtcggggcagacatctgcggc
ttctcgggcagcacctcggaggagctgtgcacccgctggatgcagctcggcgccttctac
cccttctctcgcaaccacaacacccagaacgagaaggcccaggacccaacagtgttcagc
cccgcagccaggacagccatgaaggacgtgctgctgacccgctattccctcctgcccttc
ctctacacccttttccaccgtgcccacctgcagggggacactgtggcccggcccttgttc
tttgagttccctcaggatgaggccacctgggagctggacaggcagttcctgtggggtcag
agcctgctggtaaccccagtgctggagcccggggtggactcagtcacaggttatgtcccc
caaggcacgtggtacgacttctacacgggctcctcagtgagcagcagtggggagatgttg
aagatgtcagcccctctggagcacctcaacctgcacatccgggaaggttccatcctgccc
acccagaaaccaggaaccaccacagaggccacccgagggaaccccctgcgtctcatcgtg
gccttgtcctcgcatgccactgcctggggtgaccttttctgggatgatggtgagagcctg
gacacctttgagaagggcaactactcctacgtggtgttcaatgtcacacagaacatcttc
acctccaccgtcctccatgccaccaccgaggccaccaaggtcaccgttggcacactgagc
atctttggggtgcagaagccgcccagcaaggtcctcctgaatggccaggagaagcccttt
tcctacctggacaaccaggttctcaatgtgagtgatcttggcatgagcctcagccagggc
ttctccctgcagtggctgtga

DBGET integrated database retrieval system