KEGG   Geospiza fortis (medium ground-finch): 102044736
Entry
102044736         CDS       T03755                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
gfr  Geospiza fortis (medium ground-finch)
SSDB
Motif
Pfam: TUSC2 RA Ras_bdg_2
Other DBs
NCBI-GeneID: 102044736
NCBI-ProteinID: XP_005422558
LinkDB
Position
Un
AA seq 289 aa
MLPFTIVRAAWGAEDVVCMSLLLALTLAARLCTVVTLLLSLSPDCSFTCHYRCRALVQLD
CGGPPGAGDEDDGNEQVLEKDTNVDEPSEWEKTELDQAQVEQRIKEYNSQINSNLFMSLN
KDGSYTGFIKVQLKLVRPVSVPATKRVPSLQAGRPHPQGVKRRTSFYLPKGTVKHLHILS
HTRASEVIDALLRKFTVIDNPRKFALFERSEKDEQVYLRKLGDDEQPLSMYYDEDGDLAH
EFYEETIVTKNGRKRAKLKRIHKNLIPQGIVKLEHPRIHVDFPVIICEV
NT seq 870 nt   +upstreamnt  +downstreamnt
atgctgccttttaccattgttagagcagcgtggggagcagaggatgtggtttgcatgagc
ctcttgcttgccctgaccctggcagccaggctgtgcacagtggtgaccctgctcctgtct
ctgtccccagactgcagcttcacctgccactatcgctgccgggccctagtgcagctggac
tgcggtggccccccaggcgctggtgacgaggacgatggcaatgagcaggtgttggagaag
gacaccaacgtggatgagcccagcgagtgggagaagacagagctggaccaggcgcaggtg
gagcagcggatcaaggagtacaacagccaaatcaacagcaacctcttcatgagcctgaac
aaggacggctcctacaccggcttcatcaaggtgcagctgaagctggttcgccctgtctcg
gtgccggccaccaagcgggtcccctccctgcaggcggggcggccacacccccagggggtg
aagcgccgcacgtccttctacctgcccaagggaaccgtcaagcacctgcacatcctctcg
cacacccgcgccagcgaggtcatcgatgcgctcctccgcaagttcaccgtcatcgacaac
ccccgcaagttcgccctcttcgagaggtctgagaaggatgagcaagtgtacctgcggaag
ctgggtgacgacgagcagcccctctctatgtattacgatgaggacggggatcttgcccat
gagttctacgaggagacaatcgtcaccaagaacgggaggaagcgcgccaagctgaagagg
atccacaagaacctgatacctcagggcatagtgaaactagagcatcctcgcattcacgtg
gatttcccagtgattatctgcgaggtgtga

DBGET integrated database retrieval system