KEGG   Geospiza fortis (medium ground-finch): 102044939Help
Entry
102044939         CDS       T03755                                 

Gene name
PFKM
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00010  Glycolysis / Gluconeogenesis
gfr00030  Pentose phosphate pathway
gfr00051  Fructose and mannose metabolism
gfr00052  Galactose metabolism
gfr01100  Metabolic pathways
gfr01200  Carbon metabolism
gfr01230  Biosynthesis of amino acids
gfr03018  RNA degradation
Module
gfr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102044939 (PFKM)
   00030 Pentose phosphate pathway
    102044939 (PFKM)
   00051 Fructose and mannose metabolism
    102044939 (PFKM)
   00052 Galactose metabolism
    102044939 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102044939 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gfr01009]
    102044939 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gfr03019]
    102044939 (PFKM)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102044939 (PFKM)
Protein phosphatases and associated proteins [BR:gfr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102044939 (PFKM)
Messenger RNA biogenesis [BR:gfr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102044939 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 102044939
NCBI-ProteinID: XP_005431065
LinkDB All DBs
Position
Un
AA seq 769 aa AA seqDB search
MGAGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGAKVFFVCEGYQGLVDGGDHIREATWE
SVSMMLQLGGTVIGSARCQDFRTREGRLRAARNLVKRGITNLCVIGGDGSLTGADTFRAE
WGGLLAELLKTGGITAEEAQRSSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIMEIVDA
ITTTAQSHQRTFVLEVMGRHCGYLALITALACGADWVFIPESPPEDNWEEHLCRRLAETR
DGGSRLNIIIVAEGAIDKHGKAITSDEIKALVVKRLGYDTRVTILGHVQRGGTPSAFDRI
LASRMGVEAVMALLEGTPETPACVVSLSGNQAVRLPLMECVQVTKDVTTAMNEGRFEDAV
KLRGRSFQNNWNVYKLLAHIRPPATKSGYTVAVMNVGAPAAGMNAAVRATVRIGLIHGHH
MLAVHDGFEGLAFGMVEEIGWNTVGSWTGLGGSKLGTKRTLPKKHFEEISANISKFGIHG
LIIIGGFEAFTGGLELVEGRARFEELCIPLCIVPATVSNNVPGSDFSIGADTALNTITTT
CDLIKQSAAGTKRRVFIIETMGGFCGYLATMAGLAAGADAAYIFEEPFSSRDLQANVDHL
TEKMKTTVKRGLVLRNERCNENYTTDFIYNLYCEEGKGIFDCRKNVLGHMQQGGSPTPFD
RNFGTKMGAKAVAWITGKIKECSRHGRIFANTADSACLLGMRKRSLVFQPIAELRQQTDF
EHRIPKEQWWLKLRPILKILAKYNIELDTSETAHLEHLTRKVLVPEATL
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccggcaaagccatcgccgtccttacctcagggggggacgcgcaggggatgaac
gcggccgtgcgcgccgtggtgcgcgtggggatctacaccggggccaaggtgttcttcgtg
tgtgagggctaccaggggctggtggacggtggtgaccacatcagggaggccacgtgggaa
agcgtgtccatgatgttgcagctgggtggcacggtgatcggcagcgcgcgctgccaggat
ttccgcacgcgcgaggggcggctgcgtgccgcgcggaacttggtcaagcgcggcatcacc
aacctgtgtgtgatcggcggcgacggcagcctcaccggcgccgacaccttccgtgccgag
tggggcgggctcctggcagagctgctcaaaaccggtggcatcacggcagaggaggcgcag
cgctcgagccacctgaacattgtgggcatggtgggctccatcgacaacgacttctgtggc
accgacatgaccatcggcaccgactcggcgctgcaccgcatcatggagatcgtggacgcc
atcaccaccacggcgcagagccaccagaggacttttgtgctggaggtgatggggcggcac
tgcgggtatctggcgctgatcacagccctggcctgcggtgctgattgggttttcatccct
gagtcaccccccgaggacaactgggaggagcacctgtgcaggaggctggctgagacccgt
gacggtggctccaggctcaacatcatcatcgtggctgagggtgccattgacaagcacggc
aaggccatcacctcagacgagatcaaagctctggtggtgaaacgtctggggtacgacacc
agggtgaccatcctgggccacgtccagcgtgggggaaccccctcagccttcgaccgcatc
ctggccagcaggatgggtgtggaggctgtgatggcgctgctggaggggacaccggagacg
ccggcctgcgtggtcagtctgtccggcaaccaggccgtgcgtctgcccctcatggaatgt
gtccaggtgaccaaggacgtcaccacagccatgaacgaaggacgcttcgaggatgcggtg
aagctgcggggccggagctttcagaacaactggaatgtctataagctgctggctcacatc
cgcccacctgccaccaagagcgggtacacggtggccgtgatgaacgtgggcgctccggcc
gcggggatgaacgcggccgtgcgggcaaccgtgaggatcggcctcatccacgggcaccac
atgctcgcggtgcacgatggcttcgaggggctggcctttggcatggtggaggagatcggc
tggaatacggtgggcagctggacggggctgggaggatccaaactaggcaccaagagaact
ctgcccaagaaacattttgaggagatcagcgccaacatcagcaaatttgggattcatggt
cttatcatcatcggtggcttcgaggcgttcacaggtggcctggagctggtggagggccgg
gcacgcttcgaggagctctgcatccccctgtgcatcgtgcctgccaccgtctccaacaat
gtccccggctccgacttcagcatcggcgccgacactgccctcaacaccatcaccactacg
tgtgacctgataaagcagtcggctgcaggcactaagcgccgcgtgttcatcatcgagacc
atgggtggcttctgtggctacctggccaccatggccgggctggcggctggcgccgatgcc
gcctacattttcgaggagcccttcagcagccgtgacctgcaggccaatgtggaccacctg
acagagaagatgaagaccacggtgaagagggggcttgtgctcaggaatgagcgttgcaat
gagaactacaccacagatttcatctacaacctctactgcgaggagggcaaagggattttt
gactgccggaaaaacgtcctggggcacatgcaacagggaggcagccccaccccctttgac
cgtaattttggcaccaagatgggcgccaaggccgtggcctggatcaccgggaagatcaag
gagtgctcccggcatggccggatctttgccaacacggcggactcggcgtgcctgctgggg
atgcgcaagcgcagcctggtgttccagcccatcgctgagctgcgccagcagacggatttc
gagcaccgcatccccaaggagcagtggtggctgaagctgcggcccatcctcaaaatcctg
gccaagtacaacatcgagctggacacatctgagacagcgcacctggagcacctgacccgc
aaggtcctggtccccgaggccaccctgtga

DBGET integrated database retrieval system