KEGG   Geospiza fortis (medium ground-finch): 102045131
Entry
102045131         CDS       T03755                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04010  MAPK signaling pathway
gfr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102045131 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102045131 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gfr04052]
    102045131 (KITLG)
Cytokines and growth factors [BR:gfr04052]
 Growth factors
  Growth factors (RTK binding)
   102045131 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 102045131
NCBI-ProteinID: XP_014162716
UniProt: A0A6I9Z9S0
LinkDB
Position
Un
AA seq 305 aa
MEREEVPQVLEQVCLLAVEWAMVEQTWIITCFCLQLLLLNPLVKAQSSCGNPITDDVNDI
AKLVGNLPNDYMITLKYVPKMDSLPSHCWLHLMVPEFSISLHNLLQKFSDIPDMSDVLSN
YSIINNLTRIINDLMACLAFDKNKDFVKENGHLYEEGHFIPEDFFRHFNSTIEVYKESAD
RLDKNDCILPSTVGTPENDSRVAVTKTFLFPPVAASSLRNDSIGSSTSSNKEALGFISSS
SLQGISIALTSLLSLLIGFILGALYWKKIHPKSRPESDETTQCRDYQEENEISMLQQKEK
EHLQV
NT seq 918 nt   +upstreamnt  +downstreamnt
atggagcgggaggaggtgccccaggtgctggagcaggtttgcctgctggcagttgagtgg
gccatggtggaacagacttggattatcacttgcttttgtcttcaactcctcctacttaat
cctcttgtcaaagcccagagttcctgcgggaatccaatcacagatgatgtgaatgacatt
gcaaaattggttggaaatctcccaaatgattatatgataacccttaaatatgtcccgaag
atggatagtctgcctagtcactgttggttgcatttgatggtgcctgaattttcaataagt
ctacataatcttctccagaaattttcagatattccagatatgtcagatgttttaagcaac
tattcaatcatcaataatctcacaaggataattaatgatcttatggcatgccttgctttt
gacaaaaacaaggattttgtaaaagaaaatggtcacctttatgaagaaggtcacttcatt
cctgaggatttttttaggcactttaatagtaccattgaggtctacaaagagtctgcagac
agattggataagaatgactgcattctgccttcaacagtaggaacgccagagaatgattcc
agagtcgctgtcacaaaaacatttttgtttcctcctgttgctgccagctctcttaggaat
gacagcattggcagtagcactagcagtaacaaagaagcacttggcttcattagcagctcc
agcctgcaagggatcagcatagcactgacatcgttgctatctctccttattggctttatt
ttgggagccctatactggaagaaaatacatcccaaatccagaccagaaagtgatgaaact
acacagtgtcgtgactatcaagaggaaaatgagataagcatgttgcagcaaaaagaaaag
gaacatctacaagtgtag

DBGET integrated database retrieval system