KEGG   Geospiza fortis (medium ground-finch): 102045242Help
Entry
102045242         CDS       T03755                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00590  Arachidonic acid metabolism
gfr01100  Metabolic pathways
gfr04370  VEGF signaling pathway
gfr04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102045242 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102045242 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102045242 (PTGS2)
Enzymes [BR:gfr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102045242 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 102045242
NCBI-ProteinID: XP_014163576
LinkDB All DBs
Position
Un
AA seq 549 aa AA seqDB search
MTAGPDRYECDCTRTGFYGQNCTTPEFFTWLKLALKPSPNTVHYILTHFQGVWNIINNIP
FLRDAIMRYVLTSRSHLIDSPPTYNSDYNYKTWEAYSNLSYYTRSLPPVGLDCPTPMGVK
GKKELPDSKLIVEKFLLRRKFIPDPQGTNVMFTFFAQHFTHQFFKTDQKRGPAFTRALGH
GVDLNHIYGETLERQLKLRLRKDGKLKYQMIDGEMYPPTVRDTQAEMLYPPHVPEHLRFS
VGQEVFGLVPGLMMYATIWLREHNRVCDVLKHQHPEWDDEQLFQTARLILIGETIKIVIE
DYVQHLSGYHFKLKFDPELLFNQKFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQEYTFQQ
FLYNNSIMLEHGLSHMVKSFSKQSAGRVAGGKNVPAAVQKVAKASIDQSRQMRYQSLNEY
RKRFMLKPFRSFEELTGEKEMAAELEELYGDIDAMELYPGLLVEKPRPGAIFGETMVEMG
APFSLKGLMGNAICSPEYWKPSTFGGKVGFDIINTASLQKLICNNVKGCPFTAFHILPPE
PTEATINVT
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgggccggatcgctacgagtgcgactgcaccaggacaggcttctacgggcag
aactgcaccacaccggaattcttcacgtggctgaagctagcattgaaaccatcgccaaac
actgtccactacatcctcacccacttccaaggagtctggaatatcatcaacaacattccc
ttcttaagggacgctattatgagatatgtactaacgtcaagatcacacttgattgacagc
ccaccaacttacaatagtgactacaattacaaaacctgggaagcttattccaatctttcc
tactacacaagaagccttccaccagtagggcttgactgcccaacaccaatgggtgttaaa
gggaagaaagagctcccggattcaaagctgatcgtggagaagtttttgctgaggagaaag
tttattcccgacccacaaggcacaaatgtgatgttcaccttctttgcccagcacttcacc
caccagttcttcaagacggaccagaagcggggccctgccttcaccagagcgctcggccac
ggggttgacttgaaccacatttatggagagactctggagagacaacttaaactgaggctt
cgaaaggatggaaagctaaaataccagatgatcgatggagaaatgtaccctccgacggtg
cgggacacacaggcagagatgctgtacccaccccatgtgcctgagcacctgcgcttctcc
gtggggcaggaggtgttcgggctggtgccggggctcatgatgtacgccacgatctggctg
cgcgagcacaaccgcgtctgcgacgtgctcaagcaccagcaccccgagtgggacgacgag
cagctcttccagaccgcccggctcattctcatcggagagacaatcaagatcgtcatagag
gactatgtgcagcacctgagtgggtaccacttcaagctgaagtttgaccctgagctgttg
ttcaaccagaagttccaataccagaaccgcatcgcagccgagttcaacaccctgtaccac
tggcacccgctgctgcccgacaccttccagatccacgaccaggagtacaccttccagcag
ttcctctacaacaactccatcatgctggagcatggactatcccatatggtcaaatctttc
tccaagcaaagtgctggcagggttgctggtgggaagaatgttcctgctgcagtgcagaaa
gtggcaaaggcctccattgaccaaagcaggcagatgaggtaccagtccttgaacgagtac
aggaaacgcttcatgctgaaaccattccgatccttcgaagagcttacaggagaaaaagag
atggcagcggagctggaggagctgtatggagacatcgatgccatggagctgtacccaggc
ctgctggtggagaagccccggcctggggccatctttggggagaccatggtggagatgggg
gccccattctccctgaaggggctgatgggcaacgccatctgctctcctgagtactggaag
cccagcaccttcgggggcaaggtgggctttgacatcatcaacacggcctccctgcagaag
ctcatctgcaacaacgtgaagggctgtcccttcaccgccttccacatcctgcctcccgag
cccaccgaggccaccattaatgttacttga

DBGET integrated database retrieval system