KEGG   Geospiza fortis (medium ground-finch): 102045531
Entry
102045531         CDS       T03755                                 

Gene name
STK11
Definition
(RefSeq) serine/threonine kinase 11
  KO
K07298  serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04068  FoxO signaling pathway
gfr04140  Autophagy - animal
gfr04150  mTOR signaling pathway
gfr04530  Tight junction
gfr04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102045531 (STK11)
   04150 mTOR signaling pathway
    102045531 (STK11)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102045531 (STK11)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102045531 (STK11)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102045531 (STK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gfr01001]
    102045531 (STK11)
Enzymes [BR:gfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102045531 (STK11)
Protein kinases [BR:gfr01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   102045531 (STK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 102045531
NCBI-ProteinID: XP_005428601
UniProt: A0A6I9HS69
LinkDB
Position
Un
AA seq 441 aa
MDLQEPQQLGMFAESELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEMLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVFQAHGYFCQLIDGLEYLHSQGIVHKDIKPG
NLLLTTNGTLKISDLGVAEALHPFAEDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS
AGVTLYNITTGLYPFEGDNIYKLFENIGKGDYTIPEDCGPPLSDLLRGMLEYDPAKRFSI
QQIRQHNWFRKKHAQAEALVPIPPSPETKDRWRSMTAVPYLEDLHGYNEEEDDDLYDIED
DIIYTQDFTVPGQVPEEEEAGQNGQSRGRGLPKAVCMNGTEPGQLSARAKGERRASASSN
PSRKACSASSKIRKLSTCKQQ
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggatctgcaggagccccagcagctgggaatgtttgcagagagcgagctgatgtcggtg
gggatggacaccttcatccaccgcatcgactccaccgaggtcatttaccagccccggcgc
aaacgggccaagctcatcggcaagtacctcatgggagacctgctgggagagggctcctac
ggcaaagtcaaggagatgctggactcagagactctgtgcaggagagctgtgaagatcctg
aagaagaagaagctgcgccggatccccaacggggaggccaacgtgaaaaaggagatccag
ctcctgcggagattacggcacaaaaacgtcatccagctggtggatgtgttgtacaacgag
gagaaacagaaaatgtatatggtgatggagtactgtgtgtgtgggatgcaggaaatgctg
gacagtgtcccagaaaagaggtttccagtgtttcaggctcacgggtacttttgtcagctt
atagatggcttagaatacttgcacagccaagggattgtccacaaggatataaaacctggg
aacctcctgctaacaaccaatgggacactaaaaatatctgatttaggcgtagcagaggca
ttgcatccgtttgcggaggacgacacgtgcaggacaagccaagggtcgccagcattccag
cccccagaaattgccaatggccttgacaccttttcaggctttaaagtcgacatctggtct
gcaggggtgacactatacaacatcacaacgggtctgtacccttttgaaggggataatatc
tataaattatttgaaaacattgggaaaggcgactacacaattccagaggattgtggtcct
ccactctcagacttattgagagggatgcttgaatacgacccagccaagaggttctcaata
cagcagataaggcagcacaactggtttaggaagaaacatgctcaggcagaggcgctggtg
cccatccctcccagccctgagacaaaggacaggtggaggagcatgacggcggtgccttac
ctggaggatctgcatggctacaatgaggaagaggatgatgacttgtatgacattgaagat
gatatcatctacactcaggacttcacagtaccaggacaggtgcctgaggaggaggaggcc
gggcagaacgggcagagccgcggcagggggctgcccaaggccgtgtgcatgaacgggacg
gagccggggcagctgagcgccagggccaagggcgagcgccgcgccagcgcctcctccaac
ccctcccgcaaggcctgctctgccagcagcaagatccgcaagctctccacctgcaagcag
cagtga

DBGET integrated database retrieval system