KEGG   Geospiza fortis (medium ground-finch): 102045566
Entry
102045566         CDS       T03755                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04012  ErbB signaling pathway
gfr04068  FoxO signaling pathway
gfr04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102045566 (CDKN1B)
   04068 FoxO signaling pathway
    102045566 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102045566 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102045566
NCBI-ProteinID: XP_005421098
LinkDB
Position
Un
AA seq 198 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNREFKKHMQEIKEAHQRKW
NFDFQNHRPLEGRYEWQAVEKGSSPDFYFRPPRLRKAVCKSAGRQSLDVNGNCQTVVFVG
SQGISEDTHCVAQKTDVSENQTDLAEQCTAQRKRPAADDSSPQNKRANTTEEEVSEDSPS
ASSVEQTPKKSSPGRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtccgcatttctaatgggagccctaccttggagcgcatggaggccaggcag
tcggagtacccgaagccgtcagcgtgccggaacctcttcgggccggtgaaccacgaagag
ctcaacagggagtttaagaaacacatgcaggagataaaggaggcgcaccagaggaagtgg
aatttcgatttccagaatcacaggccgctggaaggcaggtacgagtggcaagccgtggag
aaggggagctcgcccgacttctacttcagacccccccggctacggaaagccgtctgcaag
tccgccggccgccagagcttggatgtaaacgggaattgccaaaccgtggtttttgtcggt
tctcagggaatctcagaggacactcactgtgtagctcaaaagactgatgtttcagaaaat
cagacggacttagcagagcagtgcactgcccagaggaaaagacccgcggccgatgattcc
tctcctcaaaataaaagagccaacacaacagaagaagaggtttcagaagactcccccagt
gccagttcagtggagcaaacacccaagaaatcaagcccgggaagacatcaaacgtaa

DBGET integrated database retrieval system