KEGG   Gallus gallus (chicken): 100857439Help
Entry
100857439         CDS       T01006                                 

Definition
(RefSeq) histone H3
  KO
K11253  histone H3
Organism
gga  Gallus gallus (chicken)
Brite
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100857439
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100857439
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 100857439
NCBI-ProteinID: XP_015144926
CGNC: 65581
Ensembl: ENSGALG00000040004
UniProt: P84229
LinkDB All DBs
Structure
PDB: 

Position
1
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtacgaagcagacggcgcgtaagtcgacgggcgggaaggcgccccgcaagcag
ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac
cgctaccggcccggcacggtggcgctgcgcgagatccggcgctaccagaagtccacggag
ctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgagcgaggcctac
ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc
atgcccaaggacatccagctcgcccgccgcatccgcggggagcgcgcctga

DBGET integrated database retrieval system