KEGG   Gallus gallus (chicken): 100859720Help
Entry
100859720         CDS       T01006                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial isoform 1 precursor
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00020  Citrate cycle (TCA cycle)
gga00190  Oxidative phosphorylation
gga01100  Metabolic pathways
gga01200  Carbon metabolism
Module
gga_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gga_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gga_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100859720 (SDHB)
  Energy metabolism
   00190 Oxidative phosphorylation
    100859720 (SDHB)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100859720 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 100859720
NCBI-ProteinID: NP_001074344
CGNC: 63429
Ensembl: ENSGALG00000041401
UniProt: A0A1D5PIF0
LinkDB All DBs
Structure
PDB: 

Position
21
AA seq 290 aa AA seqDB search
MAAAVVGVSLRRGVPARFLRAGLRPVRGLEAVQGICRGAQTAAAATSRIKKFSIYRWDPD
KPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNT
LACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQY
LQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEER
LAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKAAAA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgtggtgggagtctccttgaggcgcggcgtccccgcgcggttcctgagg
gctgggctgcggccggtgaggggactggaggcggtccaggggatctgtcgaggagctcag
acggcggctgcagctacatcacgtatcaagaagttttccatctacagatgggatcctgat
aagcctggggacaagccccgcatgcagacctatgaagtggatttaaataaatgtgggcct
atggtacttgatgctctgattaagattaaaaacgagttggactccactctgaccttccgc
aggtcatgcagggaaggcatctgtggctcctgtgcaatgaacattgctggtggaaacacc
ctggcttgtactaaaaaaattgaccctgatctcagcaagaccactaaaatctaccctctc
ccccacatgtatgtggtgaaggatctcgttccagacttgagtaacttctacgcacagtac
aaatccatcgagccttacctgaagaagaaggacgagtcgaaacagggcaaggagcagtac
ttgcaatccatagaagaccgtcagaaactggacggactctatgagtgcatcctctgtgcc
tgctgcagcaccagctgtcccagttactggtggaatggggacaagtacttgggtcctgct
gtactcatgcaggcctatcgctggatgatcgactccagagatgactacacagaggaacgc
ctggcacaacttcaagacccgttttctctctaccgttgtcacactatcatgaactgcaca
aggacttgcccaaagggtttgaaccctggcaaagcaattgctgagatcaagaagatgatg
gcaacttacaaagagaaggcagccgctgcataa

DBGET integrated database retrieval system