KEGG   Gallus gallus (chicken): 100859876Help
Entry
100859876         CDS       T01006                                 

Gene name
ALPP
Definition
(RefSeq) intestinal-type alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00730  Thiamine metabolism
gga00790  Folate biosynthesis
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    100859876 (ALPP)
   00790 Folate biosynthesis
    100859876 (ALPP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    100859876 (ALPP)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:gga00537]
    100859876 (ALPP)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100859876 (ALPP)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100859876 (ALPP)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:gga00537]
 Enzymes
  100859876 (ALPP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 100859876
NCBI-ProteinID: XP_003641809
CGNC: 63282
Ensembl: ENSGALG00000007814
UniProt: E1C0U5
LinkDB All DBs
Position
9
AA seq 520 aa AA seqDB search
MRLLVALTLCLGLWAELGTAFIPVEEEDPSFWNRQAAAALDATLKIEPRMTEAKNLIIFL
GDGFGVPSITATRILKGQLKGNLGPETPLALDSFPYVALSKTYTVDRAVPDSAGTATAYL
CGVKGNYKTVGLSAAARYGQCNTTKGNEVISVLERARNAGKAVGIVTTSRVQHASPSGTY
AHVVDRNWYADSSMPAEAIAQGCKDIAWQLVHNVDINVIMGGGRVYMTPAGTPDPEYPEY
SSENGIRNDGQNLIEKWLSERQGARYVWNRTEMLAAAADPSVTYLMGLFEPMDMKYEMVH
NATLDPSLTEMTEAAITILSRNPKGFYLFVEGGRIDHGHHEGMAQRALTEAVEFDTAIER
AGELLDEADTLTVVTADHSHVFSFGGYILRGTSILGLAPQKAIDNKTYTSILYGNGPGYP
GATRPNVSSSTAGEFNYTQQAAVPLNSETHGGEDVAILAKGPMAYLFHGVQEQNYIAHAM
AYAACLEPYENCRQRNSAAPSTHLTPLALLLPALLLSLFH
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgctggtagccctcaccctctgcctcggcctctgggcagagctcggcactgcc
ttcatcccagtggaggaggaggatccatctttctggaacaggcaggcagccgctgccctc
gatgccaccctcaagatcgagcccaggatgacagaagccaaaaacctcatcatcttcctc
ggagatggatttggggtccccagcatcacagccacccggatcctaaaggggcagttgaag
ggaaacctgggacctgagaccccccttgctctggattctttcccctatgtggctctctcc
aagacatacactgtggaccgggcggtccctgacagcgcgggcacagccactgcctacctg
tgtggggtgaagggcaactacaagacagtggggctgagcgcggccgcacgctacggccaa
tgcaacaccacgaagggcaacgaggtgatctcggtgctggagcgagcccgtaatgctggg
aaggcagtgggcatcgtgacgacctcgcgggtgcagcacgcatcgccctcggggacctac
gcgcacgtggtggatcgcaactggtacgcggactccagcatgccagctgaggccatagca
cagggctgcaaggacatcgcctggcagctggtgcacaacgtggacatcaatgtgatcatg
ggaggcggtcgggtatacatgacccccgcggggacaccagaccctgagtatcctgaatac
agctccgagaatgggatacggaatgatgggcagaacctcatcgaaaagtggctgtcagaa
cggcagggtgcccgctatgtctggaacaggacagagatgctggctgccgccgcagacccc
agcgtgacttatctgatgggtctcttcgagcccatggacatgaagtacgaaatggtgcac
aatgccaccctggatccctctctcactgagatgacagaggcagcaatcaccatcctgagc
aggaaccccaaaggcttctacctctttgtggaaggtgggaggatcgaccacggccaccac
gagggcatggcacagcgggcactgacggaggcggtggagttcgacacggccattgagcgg
gcaggagagctgctggacgaggcggacacgctgaccgtggtcactgctgaccattctcac
gtcttctcctttggcggctacatcctgcgcggcacctccatcttgggcctggcccctcaa
aaagccatcgacaacaagacctacacctccatcctctatgggaatgggccgggctaccca
ggtgccacccggcccaatgtgagcagcagcactgccggggaattcaattacacgcagcag
gcggccgtccccctcaactcggagacccatgggggtgaggacgtggccatcctggccaaa
ggccccatggcctacctcttccacggggtgcaggagcagaactacatcgcccacgccatg
gcctacgccgcctgcctcgagccctatgaaaactgccgccagcgcaacagtgctgcaccc
tcaacccacctcaccccgctggccctgctcctgcctgctttgctcttatccctcttccac
tga

DBGET integrated database retrieval system