KEGG   Gallus gallus (chicken): 101748081
Entry
101748081         CDS       T01006                                 

Gene name
KMT5C
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5C isoform X1
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00310  Lysine degradation
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101748081 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    101748081 (KMT5C)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     101748081 (KMT5C)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101748081 (KMT5C)
SSDB
Motif
Pfam: SET
Other DBs
NCBI-GeneID: 101748081
NCBI-ProteinID: XP_025002076
CGNC: 67572
LinkDB
Position
Unknown
AA seq 380 aa
MGSRRLTARELCEIDDLATSLVLDSVLGFRTHKMGVSPLPALRRKHLLRAAVEGFRRRRD
LEAAWRALSGAWAAAFFQRRRPLQRAALKSHVFHYLRIFLPESGFAIQPCSRYSQETNGA
RVVSTRTWQKNDTLELLVGCIAELRAHDEALLRSGENDFSIMYSTRKQCAQLWLGPAAFI
NHDCRPNCKFVPAEGNVARVQVLRDIAPQDEITCFYGDSFFGDNNERCECCTCERKGEGA
FRKRSGGAQPVPPLTPPKYLLRETDRRLRRARGPGGARGHPHRQHRRRRRLRGASRPPAP
RPPQLRVVLHDCISCGGGCRLQGREPLVCLCAAAPAGAPPPQPTAATPPAVLPPLEDPKL
SLYAHVRLGPAWGSCGGAQL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggggtcgcggcggctgacagcgcgggagctgtgcgagatcgacgacctggcgaccagc
ctggtgctggactccgtgctgggcttccgcacacacaagatgggcgtcagccccctcccc
gcgctgcggcggaagcacctcctgcgggcggcggtcgaaggcttccggcggcggcgggac
ctggaggcggcgtggcgggcgctgagcggggcctgggccgcagccttcttccagcggcgg
cgcccgctgcaacgcgccgcgcttaagagtcacgttttccactacctgcgcatcttcctc
cctgagagtggctttgccatccagccctgcagccgctactcacaggagaccaacggcgcc
cgtgtggtctccactcgcacctggcagaagaatgacacgctggagctgctggtgggctgc
atcgccgagctgcgggcgcacgacgaggcgctgctgcgctcaggggagaacgacttcagc
atcatgtattccacgcgtaagcagtgtgcccagctctggttgggccctgctgccttcatc
aaccacgactgccggcccaactgcaagtttgtgcctgcggaggggaacgtggcacgggtg
caggtgctgcgggacatcgcgccgcaggacgagatcacgtgcttctatggggacagcttc
ttcggggacaacaacgagcgctgcgagtgctgcacctgcgagaggaagggtgaaggcgcc
ttccggaaacgcagtgggggggctcagccggtgccccccctcacaccccccaaatacctc
ctgagggagacagacagacgtctgcgccgtgccaggggtccggggggggcacggggccac
ccccaccgacagcaccgccgccgccgccgccttcgtggcgccagccgccccccagccccg
cgacccccccagctccgcgttgtcctccacgattgcatctcttgcggggggggctgccgc
ctgcagggcagggaacccctcgtctgcctgtgcgccgctgcccccgccggagccccccca
ccccagcccaccgccgccaccccccccgccgtgctcccccctttggaagaccccaagctc
tccctttacgcccacgtgcgcctgggccctgcgtgggggagctgcgggggggcgcagctg
tga

DBGET integrated database retrieval system