KEGG   Gallus gallus (chicken): 101750777
Entry
101750777         CDS       T01006                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: RA Nore1-SARAH Ras_bdg_2
Other DBs
NCBI-GeneID: 101750777
NCBI-ProteinID: XP_015148275
CGNC: 70219
Ensembl: ENSGALG00000038951
LinkDB
Position
12
AA seq 185 aa
MSLNKDGSYTGFIKVHLKLARPVSVPAAKRGPGGRPGQRTAGVKRRTSFYLPRGTVKHLH
VLSHTRASEVIGALLRKFTVVDDPRKFALFERSEKDEQVYLRKLADDEQPLRLRLLAGPS
EKALSFVLKENESGEVNWDAFSLPELHNFLRILQREEDEQLRRVRHRYARCRRELQAALA
ARTPG
NT seq 558 nt   +upstreamnt  +downstreamnt
atgagcctgaacaaggatggctcctacaccggcttcatcaaggtgcacctgaagctggca
cgccccgtctctgtgccggccgccaagcggggccctggggggcggccggggcagcgcacg
gcgggcgtgaagcgccgcacgtccttctacctgccccgcggcaccgtcaagcacctgcac
gtgctctcccacacccgcgccagcgaggtgatcggcgcgctgctccgcaagttcaccgtg
gtggacgacccccgcaagttcgccctcttcgagcggtccgagaaggatgagcaagtgtac
ctgcgcaagctggcggacgacgagcagccgctgcggctgcggctgttggcagggcccagc
gagaaggcgctgagcttcgtcctgaaggagaacgagagcggcgaggtgaactgggacgcc
ttctcgctgccagagctgcacaacttcctgcgcatcctgcaacgcgaggaggacgagcag
ctgcgccgcgtccgccaccgctacgcccgctgccgccgggagctgcaagccgcgttggcc
gcccgcacgccgggctga

DBGET integrated database retrieval system