KEGG   Gallus gallus (chicken): 107050456Help
Entry
107050456         CDS       T01006                                 

Definition
(RefSeq) glycogen [starch] synthase, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00500  Starch and sucrose metabolism
gga01100  Metabolic pathways
gga04910  Insulin signaling pathway
Module
gga_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107050456
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107050456
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gga01003]
    107050456
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     107050456
Glycosyltransferases [BR:gga01003]
 Polysaccharide
  Storage polysaccharide
   107050456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 107050456
NCBI-ProteinID: XP_025001231
CGNC: 73470
LinkDB All DBs
Position
33
AA seq 688 aa AA seqDB search
MPLARSMSVSSLPGLEDWGGPPENAVLFEVAWEVANKVGGIYTVLQTKARVTADEWGEGY
VLVGPYVESSVRTQVELLEPPQPALRRTLQAMNSQGCKVHFGRWLIEGSPAVVLLDVGAT
AWSLDRWKSELWESCAIGVPWYDREANDAVLFGFLVAWFLGEFAAQSEDRPFIVGHFHEW
LAGLGLVLCRARRLPVATIFTTHATLLGRYLCAGSVDFYNNLQNFDVDKEAGERQIYHRY
CLERAAAHCAHVLTTVSHVTAGEAEHLLKRKPDLVTPNGLNVRKFSAMHEFQNLHAQSKA
RVQEFVRGHFYGHLDFDLDKTLFFFIAGRYEFSNKGADIFLEALARLNYLLRVNGSETTV
VAFFIMPARTNNFNVESLKGQAVRKQLWDTANAVKEKFGKKLYESLLVGNLPDMNKMLDR
EDFTMMKRAIFATQRQSFPPVCTHNMLDDATDPILTTIRRIGLFNSGNDRVKIIFHPEFL
SSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYNPAECTVMGIPSVSTNLSGFGCFMEEHI
ADPSAYGIYIVDRRFRAPEESCAQLTAFLYGFCQQSRRQRIVQRNRTERLSDLLDWKYLG
RYYTFARRMALAKAFPEHFTYEPPEAAAAGSATPAPPPFPPPPPCRAFPAPATATTRRTS
ATTRKRRRPKTAPTSAAPPPRRDPPTRN
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggcccgcagcatgtcggtcagctccttgccaggcctggaggactgggggggg
ccccccgaaaacgccgtcctctttgaggtggcctgggaagtagccaacaaagtgggcggc
atctacacggtgctgcagacgaaggcgcgggtgacggcggacgagtggggcgagggctac
gtgctggtggggccctacgtggagagcagcgtgaggacgcaggtggagctgctggagccc
ccccagcccgccctgaggcgcaccctgcaggccatgaactcccagggctgcaaggtacac
tttgggcgctggctgatcgagggcagcccagccgtggtgctgctggacgtgggggcgacc
gcctggagcctggaccgctggaagagcgagctgtgggagagctgcgccatcggcgtgccc
tggtacgaccgcgaggccaacgatgctgtgctcttcggcttcctcgtcgcctggttcctg
ggagagtttgcagctcagagcgaggaccgtcccttcatcgtggggcacttccacgagtgg
ctggcggggctggggctggtgctgtgccgcgcgcgccgcttgcccgtggccaccatcttc
accacccacgccacgctgctgggccgctacctctgcgccggcagcgtggacttctacaac
aacctgcagaactttgacgtggacaaggaggcgggcgagcggcagatctaccaccggtac
tgcctggagcgcgcggccgcgcactgcgcccacgtcctcaccaccgtgtcccacgtcacc
gccggcgaggccgagcacctcctgaaacggaaacccgacctggtgacccccaacggcctc
aacgtccgcaagttctcagccatgcatgagttccagaacctgcacgcccagagcaaggcg
cgggtgcaggagtttgtgcgggggcacttctatgggcacctggacttcgacctggacaag
acgctcttcttcttcatcgcggggcgctatgagttctccaacaaaggcgccgacatcttc
ctcgaggcgctggcgcggctcaactacctgctgagggtgaacggcagcgagacgacggtg
gtggccttcttcatcatgccggcacgcaccaacaacttcaacgtggagtccctgaagggg
caggccgtgcgcaaacagctctgggacacagccaacgcggtgaaggagaagtttgggaag
aagctctatgagtcgctgctggtggggaacctcccggacatgaacaagatgttggaccgg
gaggacttcaccatgatgaaacgcgccatcttcgccacccagcgccaatccttcccccct
gtgtgcacccacaacatgttggacgacgccaccgaccccatcctcaccaccatccgccgc
attgggctcttcaacagcggcaacgaccgcgtgaagattatcttccaccccgagttcctg
tcctccaccagccccctcctgcccgtcgactacgaggagttcgtgcgcggctgccacctc
ggggtcttcccctcctactacgagccctggggttacaaccccgctgagtgcaccgtgatg
ggcattcccagcgtctccaccaacctgtcggggttcggctgcttcatggaggagcacatc
gccgacccctctgcctatgggatttacatcgtggaccgccggttccgggctccggaggag
tcgtgcgctcagctcacagctttcctctacggcttctgccagcagagccggcggcagcgc
atcgtgcagcgcaaccgcaccgagcggctgtccgacctgctggactggaagtacctggga
aggtactacaccttcgcacgccgcatggctctggccaaggccttccccgagcacttcacc
tatgagccccccgaggcggcggcggcaggttccgctacccccgccccgcctccgttcccc
cctcccccgccctgtcgcgcatttccagcccccgccacagcgacgacgaggaggacgagc
gctacgacgaggaagaggaggcggccaaagaccgcgccaacatccgccgcccccccaccc
cgtagggacccccccaccaggaactga

DBGET integrated database retrieval system