KEGG   Gallus gallus (chicken): 107054568Help
Entry
107054568         CDS       T01006                                 

Definition
(RefSeq) trypsin II-P29
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
gga05164  Influenza A
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107054568
 09160 Human Diseases
  09167 Infectious diseases
   05164 Influenza A
    107054568
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gga01002]
    107054568
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    107054568
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     107054568
Peptidases [BR:gga01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107054568
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107054568
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 107054568
NCBI-ProteinID: XP_015149651
CGNC: 77542
Ensembl: ENSGALG00000032796
UniProt: A0A1D5PN36
LinkDB All DBs
Position
1
AA seq 248 aa AA seqDB search
MNSLFLILSCLGAAVAFPGGADDDKIVGGYTCPEHSVPYQVSLNSGYHFCGGSLINSQWV
LSAAHCYKSRIQVRLGEYNIDVQEDSEVVRSSSVIIRHPKYSSITLNNDIMLIKLASAVE
YSADIQPIALPSSCAKAGTECLISGWGNTLSNGYNYPELLQCLNAPILSDQECQEAYPGD
ITSNMICVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGIGCALKGYPGVYTKVCNYVDW
IQETIAAY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaattctctcttcctgattctctcctgcctgggagcagctgttgctttccctggaggt
gccgatgatgacaagattgtgggaggctacacctgcccagagcattcggttccctaccag
gtgtccctgaactctgggtatcacttctgtggagggtccctcatcaacagccagtgggtc
ttgtcagctgctcactgctataaatcccgtatacaagtgaggctgggagagtacaacatc
gatgtgcaggaagacagcgaagtagtcagaagttcatcagtaatcattcgccatcctaaa
tacagttcaataaccctcaataatgacattatgttgatcaagttggcatctgcggtggaa
tacagtgccgacattcaacccatagctctgcccagctcctgtgccaaggcggggaccgag
tgcctgatctcagggtggggaaacacgctgagcaatggctacaattaccctgaacttctc
cagtgcctgaacgctccgattctgagtgaccaagagtgccaggaggcctacccgggtgat
atcaccagcaacatgatctgtgtcgggttcctggagggtgggaaagactcgtgccagggt
gactcgggtggaccagttgtgtgcaatggagaactgcaaggaattgtgtcctggggaatt
ggatgtgctctgaaaggctatcccggagtttacaccaaggtctgcaattacgttgactgg
atccaggaaaccattgcagcctactga

DBGET integrated database retrieval system