KEGG   Gallus gallus (chicken): 373889Help
Entry
373889            CDS       T01006                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00010  Glycolysis / Gluconeogenesis
gga00051  Fructose and mannose metabolism
gga00052  Galactose metabolism
gga00500  Starch and sucrose metabolism
gga00520  Amino sugar and nucleotide sugar metabolism
gga00524  Neomycin, kanamycin and gentamicin biosynthesis
gga01100  Metabolic pathways
gga01200  Carbon metabolism
gga04910  Insulin signaling pathway
Module
gga_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gga_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    373889 (HK1)
   00051 Fructose and mannose metabolism
    373889 (HK1)
   00052 Galactose metabolism
    373889 (HK1)
   00500 Starch and sucrose metabolism
    373889 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    373889 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    373889 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    373889 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    373889 (HK1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     373889 (HK1)
Membrane trafficking [BR:gga04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    373889 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 373889
NCBI-ProteinID: NP_989432
CGNC: 3101
Ensembl: ENSGALG00000004222
UniProt: Q8AYP8
LinkDB All DBs
Position
6
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKEDQVKKIDKYLYAMRLSDETLIDIMARFRREMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIYNTPEDIIH
GSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGILITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELPTKGKFETKHVSAIEKSKEGLNKAKEILTRLG
VEPSHEDCIAVQHVCTIVSFRSANLAASTLGAILNQLRDNKGVGRLRTTVGVDGSLYKMH
PQYARRLHKTTRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLSEQHRLIDETLAEFKLT
HEQLLQVKKRMRTEMEAGLKKKSHETAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGIRGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNIEMVDGEQGRMCVNMEWGAFGDNGCLDD
IRTIYDKAVDDYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTRH
IFETKFLSQIESDRLALLQVRTILQQLGLNSTCDDSIIVKTVCGGVSKRAAQLCGAGMAA
VVDKIRENRGLEHLEITVGVDGTLYKLHPHFSRIMHQTVKDLAPKCDVTFLLSEDGSGKG
AALITAVGCRVRDAEQN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcccagctcctggcctactacttcaccgagctcaaggaggatcaggtcaaa
aagatcgataaatacctttacgccatgcggctctctgatgaaactctgatagacatcatg
gctcgcttccggagagaaatgaagaatggcctctccagagattttaacccaacagcgaca
gtgaaaatgctccctacctttgtgaggtccattcctgatggctcagagaaaggagatttc
atcgctctggatctcggtggttcttactttcgaattctgcgggtgaaagtatcgcatgaa
aagaagcagacggtacaaatggaaagtgaaatttataatacacctgaagatatcattcat
ggcagtgggacacggctttttgatcatgttgccgaatgcctgggagactttatggagaaa
caacaaatcaaagacaagaaattaccggttgggtttaccttctctttcccgtgccgacaa
tctaagctggatgagggcattctgataacctggacgaagcgcttcaaagcgagcggagtg
gagggagcagacgttgtgaagctgcttaacaaggccatcaagaaacgtggggactatgat
gcagatatcatggctgttgtgaacgataccgttggcactatgatgacctgtggttttgat
gaccaacgttgtgaagttggcttgatcattggcactggtaccaatgcctgttacatggag
gagatgcggcacattgacctggtggaaggggacgagggcaggatgtgcataaacacagag
tggggggcctttggggatgacggctcactagaagacatcaggacagagtttgatagagag
atcgaccgtggatccctaaatcctggcaagcaactgtttgagaagatggtcagcgggatg
tacatgggggagctggtgaggctcatcctggtgaagatggccaaggagggactgctcttt
gaggggagaatcacccctgagcttcccaccaaaggaaagtttgagacaaagcatgtttct
gccatagaaaagagcaaagaaggtttgaacaaagccaaagaaatcttaacccgcctgggg
gtggagccgtcccacgaggactgcatcgcagtccagcacgtctgcaccatcgtgtccttc
cgctcggccaacctggcggcctccacgctgggtgccatcctcaaccagctgcgggataac
aaaggggtcggccgcctccgcaccaccgtgggtgtcgatggctccctctacaagatgcat
ccacagtatgctcggcgcttgcacaaaaccacccggcgcctggtgcctgactcggatgtg
cggttcctgctgtcggagagcggcagtgggaaaggggcggcgatggtgacggcggtggcg
taccggctgtcggagcagcaccggctcatcgacgagacgctggctgagttcaagctcacc
cacgagcagctgctgcaggtgaagaagaggatgaggacagagatggaagcaggcctgaag
aagaagagtcacgagactgccaaagtgaaaatgctgcccacctttgtccgcagcacgccg
gatggcacagagaacggagactttctggcgcttgaccttggagggacaaacttcagagtg
ttgctggtgaaaattcgcagtggtaaaaggagaacggttgaaatgcacaacaagatctat
gcaattcctatagaggtgatgcagggaacgggagaagagctgtttgaccacatcgttacc
tgcatttcggacttcctggattatatgggaataagaggtgcacggcttcctcttggcttc
acattctccttcccttgcaagcagaccagtctggacgctggtatccttctcaactggaca
aaaggattcaaagctacagactgtgagggtgaagacgtggtgtatttgctaagagaagga
attaaaagaagagaggagtttgacttggatgtggtagctgtagtgaacgatacggtgggc
acgatgatgacctgtgcttatgaagacccaaactgtgaaattggactcattgtgggaact
ggcagcaatgcctgttacatggaggagatgagaaacatagagatggtggatggtgagcaa
ggacggatgtgtgtgaacatggagtggggagctttcggggataatggatgcctggacgat
atcaggacaatatatgacaaagcagttgatgactattcactaaatgctggaaagcaaagg
tatgagaagatgatcagtgggatgtacctgggggaaatagtccgcaatattttgattgac
ttcaccaaacgagggttcctgttcagaggacagatctcagagactctgaaaaccaggcat
atctttgaaaccaagttcctttcacagattgagagcgacaggttagccttgcttcaggtg
cgaaccattctccagcagctggggctcaacagcacgtgcgatgacagtatcattgtcaag
acagtgtgcggaggggtgtcaaagcgagcagctcagttatgtggtgccggaatggctgcc
gttgtagataaaattagggagaacagaggcttagagcacctggagataacggttggtgtg
gatgggactctgtacaaactacacccacacttttcgaggattatgcaccaaacagtcaaa
gacctggcacccaagtgtgatgtgaccttcctgctctcggaggacggcagtgggaaaggg
gcagcgctcatcacggcggtgggatgcagggttcgcgatgctgagcagaactga

DBGET integrated database retrieval system