KEGG   Gallus gallus (chicken): 373958
Entry
373958            CDS       T01006                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2 precursor
  KO
K05429  interleukin 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
gga04625  C-type lectin receptor signaling pathway
gga04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    373958 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    373958 (IL2)
   04672 Intestinal immune network for IgA production
    373958 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    373958 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    373958 (IL2)
Cytokines and growth factors [BR:gga04052]
 Cytokines
  Interleukins
   373958 (IL2)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Cytokines
   373958 (IL2)
SSDB
Motif
Pfam: IL15 DUF5482 Cass2 DUF4132 TSNAXIP1_N DUF272 Nop
Other DBs
NCBI-GeneID: 373958
NCBI-ProteinID: NP_989484
CGNC: 48979
Ensembl: ENSGALG00000011849
UniProt: O42288
LinkDB
Position
4
AA seq 143 aa
MMCKVLIFGCISVAMLMTTAYGASLSSEKWKTLQTLIKDLEILENIKNKIHLELYTPTET
QECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICE
ANNKKKFPDFLHELTNFVRYLQK
NT seq 432 nt   +upstreamnt  +downstreamnt
atgatgtgcaaagtactgatctttggctgtatttcggtagcaatgctaatgactacagct
tatggagcatctctatcatcagaaaaatggaaaactcttcaaacattaataaaggattta
gaaatattggaaaatatcaagaataagattcatctcgagctctacacaccaactgagacc
caggagtgcacccagcaaactctgcagtgttacctgggagaagtggttactctgaagaaa
gaaactgaagatgacactgaaattaaagaagaatttgtaactgctattcaaaatatcgaa
aagaacctcaagagtcttacgggtctaaatcacaccggaagtgaatgcaagatctgtgaa
gctaacaacaagaaaaaatttcctgattttctccatgaactgaccaactttgtgagatat
ctgcaaaaataa

DBGET integrated database retrieval system