KEGG   Gallus gallus (chicken): 374064Help
Entry
374064            CDS       T01006                                 

Gene name
PFKM
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00010  Glycolysis / Gluconeogenesis
gga00030  Pentose phosphate pathway
gga00051  Fructose and mannose metabolism
gga00052  Galactose metabolism
gga01100  Metabolic pathways
gga01200  Carbon metabolism
gga01230  Biosynthesis of amino acids
gga03018  RNA degradation
Module
gga_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    374064 (PFKM)
   00030 Pentose phosphate pathway
    374064 (PFKM)
   00051 Fructose and mannose metabolism
    374064 (PFKM)
   00052 Galactose metabolism
    374064 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    374064 (PFKM)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     374064 (PFKM)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     374064 (PFKM)
Messenger RNA biogenesis [BR:gga03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     374064 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 374064
NCBI-ProteinID: NP_989554
CGNC: 10017
Ensembl: ENSGALG00000033271
UniProt: A0A1D5PG85 Q90YA3
LinkDB All DBs
AA seq 782 aa AA seqDB search
MAQPPKHCGSGEHMGAGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGAKVYFVHEGYQGL
VDGGDNLKEATWESVSMMLQLGGTVIGSARCQDFRTREGRLKAARNLVKRGITNLCVIGG
DGSLTGADTFRAEWSSLLAELLKTGGITAEEAKKSSHLNIVGMVGSIDNDFCGTDMTIGT
DSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALITSLACGADWVFIPESPPEDG
WEDHLCRRLTETRLGGSRLNIIIVAEGAIDRHGKAITSDDVKDLVVKRLGYDTRVTILGH
VQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDV
TTAMNERRFDDAVKLRGRSFQNNWNVYKLLAHIRPPSTKSGHTLAVLNVGAPAAGMNAAV
RSTVRIGLIHGHRMLAVHDGFEGLALGKVEDISWDMVGGWTGLGGSKLGTKRTLPKKYFE
EISATISTFGIHGLIIIGGFEAFMGSLELMDGRAKFEELCIPICVIPATVSNNVPGSDFS
IGADTALNTITTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEH
FSIRDLQINVEHLTEKMKTTVKRGLVLRNEHCNENYTTDFIYNLYTEEGKGIFDCRKNVL
GHMQQGGAPTPFDRNFGTKMGAKSVAWITGKIKECSRHGRIFANTADSACLLGMRKRSLV
FQPLTELKEQTDFQHRIPKEQWWLKLRPILKILAKYNIELDTSEKALMEHVRQKRISQES
NI
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcccccgaagcattgcgggagcggggagcacatgggtgctggaaaagccatc
gctgtcctcacctcagggggggacgcacagggcatgaatgcggctgtccgcgccgtggtg
cgggtgggcatttacaccggtgccaaagtctacttcgtgcatgagggctaccaggggctg
gtggacggcggggacaacctcaaagaggccacgtgggagagcgtctccatgatgctgcag
ttgggtgggacggtcatcggcagcgcccgctgccaggatttccgcacacgcgaaggacgc
ctgaaagccgcccgcaatctggtgaagcgcggcatcaccaacctctgcgtcatcggcggc
gacggcagcctcaccggtgccgacaccttccgtgccgaatggagcagcctcctggccgag
ctgctgaaaacaggggggatcacggcggaggaggcgaagaagtcgagccacctgaacatc
gtgggcatggtgggctccatcgacaacgacttctgtggcacagacatgaccatcggcacc
gactcagcgctgcaccgcatcatggagatcgtggatgccatcaccaccacagcccagagc
caccagaggacgtttgtgctggaagtgatgggtcgtcactgcggctacctggctctcatc
acctccctggcctgcggtgctgactgggtcttcatccctgagtccccccctgaggatggc
tgggaggaccacttgtgccgaaggctcacggagacccgtttgggtggctcaaggctgaac
atcatcatcgtggctgagggtgccatcgacagacacggcaaggccatcacctctgacgac
gtcaaagatctggtggtgaagcgtttgggctacgacacccgcgtcaccatcctgggccac
gtgcagcgcggtgggacaccctccgcctttgaccgcatcctgggcagcaggatgggagtt
gaagccgtcatggccttgctggaagggacccccgatacccctgcctgtgtcgtcagcctc
tcagggaaccaggccgtgcgcctgcccctcatggagtgcgtgcaggtgaccaaagatgtg
acaacagcgatgaatgagagacgcttcgatgacgctgtgaaactgcggggccggagtttc
caaaataactggaacgtctacaagctgctggcacacatccgcccaccctccaccaagagc
ggtcacacattggctgtgctcaatgtgggtgccccagctgctggcatgaacgcggccgtg
cgttccaccgtgaggatcggactcatccatgggcacaggatgctggcggtgcacgacggc
ttcgaggggctcgccttggggaaagtcgaagatatcagctgggatatggttggcggctgg
acaggtctggggggatccaaactggggacgaagaggaccttgcccaagaaatacttcgag
gaaatcagcgccaccatcagcaccttcggcatccacgggctgatcatcatcgggggcttt
gaggccttcatgggcagcctggagctgatggacgggagagccaagtttgaggagctctgc
atccccatctgcgtcatccccgccaccgtctccaacaacgtccccggctccgacttcagc
atcggcgccgacaccgctctcaacaccatcaccacgacctgcgaccgcatcaagcagtcg
gcggcggggaccaagcggcgcgtcttcatcatcgagacgatgggcggctactgcgggtac
ctggccaccatggcagggctggcagccggtgctgatgctgcctacatcttcgaggagcac
ttcagcatccgtgacctgcagatcaacgtggagcacttaactgaaaagatgaagacgacg
gtgaagcgcgggctggtgctcaggaatgagcactgcaacgagaactacaccactgacttc
atctacaacctctacacggaggagggcaaaggcatcttcgactgccgcaagaacgtactg
ggacacatgcagcagggtggcgccccgaccccctttgacaggaatttcggcactaaaatg
ggcgccaagtcggtggcttggatcactggcaagatcaaggagtgctcccggcacggtcgc
atctttgccaacacggctgactcggcgtgcctgctgggcatgcgcaagcgcagcctggtc
ttccagcccctcaccgagctcaaggagcagacagacttccagcaccgcatccccaaggaa
cagtggtggctgaagctgcgccccatcctgaagatcctggccaagtacaacatcgagctg
gacacctcggagaaggcactcatggagcacgtcaggcaaaagaggatctcacaggaatcc
aacatatga

DBGET integrated database retrieval system