KEGG   Gallus gallus (chicken): 374106
Entry
374106            CDS       T01006                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
gga  Gallus gallus (chicken)
Pathway
gga04012  ErbB signaling pathway
gga04068  FoxO signaling pathway
gga04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    374106 (CDKN1B)
   04068 FoxO signaling pathway
    374106 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    374106 (CDKN1B)
SSDB
Motif
Pfam: CDI DUF2742
Other DBs
NCBI-GeneID: 374106
NCBI-ProteinID: NP_989587
CGNC: 49044
Ensembl: ENSGALG00000022980
UniProt: Q8JIV2
LinkDB
Position
1
AA seq 198 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNRDLKKHRKEMEEACQRKW
NFDFQNHKPLEGRYEWQAVEKGSSPDFYFRQPRLSKAVCKSAGRQSLDVNGNCQTAICAA
SQGISEDTHCVGRKTDVAGSQTDFAEQCAGQRKRPAADDSSPQNKRANTTEEEVSEDSPS
ASSVEQTPKKSSPRRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtccgcatttctaatgggagccctaccctggagcgcatggaggcgcggcag
tcggagtacccgaagccgtcggcctgcaggaacctcttcgggccggtaaaccacgaagag
ttaaacagggacttgaagaagcaccgcaaggaaatggaagaggcatgccagaggaagtgg
aatttcgatttccagaaccacaagccgctggaaggcaggtacgagtggcaagccgtggag
aaggggagctcgcccgacttctacttcaggcagccgaggctatccaaagccgtctgcaag
tccgccggccgtcagagcctggatgtaaacgggaattgccaaaccgcgatttgcgccgct
tctcagggaatctcagaggacactcactgtgtaggccgaaagactgatgttgctggcagt
cagacggactttgcagagcagtgcgccgggcagaggaaaagacccgccgccgacgattcc
tctcctcaaaataaaagagccaacacaacagaagaggaggtttcagaagactcccccagt
gccagttcagtggagcaaacacccaagaaatcgagcccgagacgacatcaaacgtaa

DBGET integrated database retrieval system