KEGG   Gallus gallus (chicken): 378914
Entry
378914            CDS       T01006                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
gga  Gallus gallus (chicken)
Pathway
gga04012  ErbB signaling pathway
gga04068  FoxO signaling pathway
gga04110  Cell cycle
gga04115  p53 signaling pathway
gga04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    378914 (CDKN1A)
   04068 FoxO signaling pathway
    378914 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    378914 (CDKN1A)
   04115 p53 signaling pathway
    378914 (CDKN1A)
   04218 Cellular senescence
    378914 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 378914
NCBI-ProteinID: NP_989727
CGNC: 49142
Ensembl: ENSGALG00000028318
UniProt: Q8AYE7
LinkDB
Position
26
AA seq 141 aa
MPCSSKACRNLFGPVDHEQIQNDFEQLLRQQLEEAQRRWNFNFETETPLEGHFKWERVLL
AEQPPWEAFSLAKATSGGDNGSSAPHRVPPRDGVGGAHRGAAQQSSELAGVGSPQRLKRG
QTTIKDFYGSKRRVVHDKPKL
NT seq 426 nt   +upstreamnt  +downstreamnt
atgccgtgcagcagcaaagcgtgcaggaacctcttcggccccgtagaccacgagcagatc
cagaacgactttgagcagctgttgaggcagcagctggaagaagctcagcggcgctggaac
ttcaacttcgagaccgagacgcccctggaagggcacttcaagtgggagagggtcctgctg
gccgagcagcccccctgggaggccttcagcctggccaaggccaccagcggcggtgacaac
gggagctcagcgccccaccgggtcccccccagggatggtgtcggtggggctcatcgtggg
gcagcccagcagagctcagagctcgccggggtcggttctccccagcgcttgaaacgcggg
cagaccaccatcaaagacttctacggctccaagagaagagttgtccacgataagcccaag
ctgtga

DBGET integrated database retrieval system